KEGG   Gordonia bronchialis: Gbro_0437Help
Entry
Gbro_0437         CDS       T01102                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gbr  Gordonia bronchialis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gbro_0437
DNA repair and recombination proteins [BR:gbr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Gbro_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485947..486558
Genome map
AA seq 203 aa AA seqDB search
MYEGPIQDLIDELAKQPGLGPKGAQRIAFALLAGEKSEIDRLVAALGRVRDDVTFCAECG
NVSANRLCRICSDARRDATKICVVEEPKDVHAIERTKEFNGRYHVLGGALDPLSGIGPDQ
LRIRELLRRLANTDDGNDVTEIIVATDPNTEGEATATYLLRMLKEFPGLSVTRLASGLPM
GGDLEFADELTLGRALSGRRVLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaggggccgatccaggatctgatcgacgaactggccaaacagcccggtctggga
cccaagggcgcccagcggatcgcgttcgcgctgctggccggcgagaagtcagagatcgac
cggctggtcgccgcgctgggccgggtacgtgacgacgtcacgttctgcgccgagtgtggc
aacgtgtcggccaaccggctctgccggatctgctccgacgcccgacgcgacgcgaccaag
atctgcgtcgtcgaagagcccaaggatgtgcacgccatcgagcggaccaaggagttcaac
ggccgctatcacgtgctgggcggtgcgctggacccgctgtcggggatcgggccggatcag
ttgcggatccgcgagctgctgcgacgcctggccaacaccgacgacggcaacgacgtcacc
gagatcatcgtcgccaccgaccccaacaccgagggtgaggccaccgcgacctatctgctg
cggatgctcaaggagtttcccgggctgtcggtgacccgcctcgcgtcgggcctgccgatg
ggcggcgatctcgaattcgccgacgaactcaccctcggccgcgccctgtccgggcggcgc
gttctcgcctga

DBGET integrated database retrieval system