KEGG   Gordonia bronchialis: Gbro_0845Help
Entry
Gbro_0845         CDS       T01102                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gbr  Gordonia bronchialis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gbr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gbr00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904389..904928
Genome map
AA seq 179 aa AA seqDB search
MSPERGPVLLVNLPLALCDVSNVKDIPVTALDGSALNLTDFTGPLLVVNVASKCGLTPQY
TGLEELAKTYGDRGLTVVGMPCNQFMGQEPGTAEEIATFCSTSYGVTFPLLEKADVNGDD
RHPLYAELTKATDDSGEAGDVQWNFEKFLVNADGEVVNRFRPRTEPTDPAVVSAIESVL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccgagcggggccccgtcctcctcgtgaaccttccgctagcgttgtgtgacgtg
agcaacgtcaaagacatcccggttaccgcgctcgatggcagcgcactgaatctcaccgac
ttcaccggcccactgctggtggtcaacgtggccagtaaatgcggcctgacaccccagtac
accggactggaagagctggccaagacctacggcgatcgcggcctcacggtcgtcggtatg
ccgtgcaaccagttcatgggccaggagccgggcaccgccgaggagatcgccaccttctgc
tcgaccagctacggcgtgaccttcccgctgctggagaaggccgacgtcaacggcgacgac
cggcacccgctgtacgccgagctgaccaaggcgaccgacgactccggcgaggccggcgac
gtgcagtggaacttcgagaagttcctcgtcaacgccgacggtgaggtggtcaaccgcttt
cggccccgcaccgaaccgaccgatcccgcggtggtctcggctatcgagagcgtcctgtag

DBGET integrated database retrieval system