KEGG   Gordonia bronchialis: Gbro_0910Help
Entry
Gbro_0910         CDS       T01102                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gbr  Gordonia bronchialis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Gbro_0910
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbro_0910
   00650 Butanoate metabolism
    Gbro_0910
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Gbro_0910
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbro_0910
   00622 Xylene degradation
    Gbro_0910
   00621 Dioxin degradation
    Gbro_0910
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Gbro_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967933..968838
Genome map
AA seq 301 aa AA seqDB search
MAAKLTAAIIGSGNIGTDLMYKLERSEVIEPRWMVGIDADSEGMKRAADHGLITLSGGAD
ELLGSSERPDLIFEATSAYVHREYAPRYADAGITAIDLTPAAVGPAVVPPANLREHLEAP
NTNMITCGGQATIPMVHAVSSVVPVPYAEIVASVASVSAGPGTRANIDEFTATTSKGIET
IGGATRGKAIIILNPADPPMIMRDTIFCAIPDDADTDAIAESIHKREKEIQSYVPGYRLL
QDPQFDPPSVLNGGHARVSIFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAKQKLRVP
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccaagctgaccgcagcgatcatcgggtcgggcaacatcggcaccgacctgatg
tacaagctcgaacgttcggaggtgatcgagccccggtggatggtgggcatcgacgccgac
tccgaagggatgaaacgggccgccgatcatggcctgatcacgttgagcggtggggccgac
gaactcctcggctccagcgaaaggcccgacctcatcttcgaggcgacctcggcctatgtg
caccgcgagtatgcgccgaggtatgccgacgccggcatcactgccatcgacctcaccccc
gccgcggtcggtccggcggtggtgccaccggccaatctgcgcgagcatctcgaggcgccg
aacaccaacatgatcacctgcggtggccaggccaccatcccgatggtgcatgcggtgagt
tcggttgtgccggttccgtatgcggagatcgtcgcatcggtggcctcggtgtcggccgga
ccgggtacccgcgccaacatcgacgagttcaccgccacgacgtcgaagggcatcgagacc
atcggcggtgcgacgcgcgggaaggccattatcatcctcaacccggccgatccgccgatg
atcatgcgcgacaccatcttctgtgccatccccgacgatgccgacaccgatgccattgcg
gagtcgattcacaagcgggagaaggagatccagtcctacgtgcccggctaccggttgctg
caggacccgcagttcgatccaccgagcgtcctcaacggcggtcacgcccgggtgtcgatc
ttcgtggaggtcgagggtgcgggcgacttcctgcccccgtacgccggcaacctggacatc
atgaccgccgccgccaccaaggtcggcgaggagatcgcgaagcagaagttgagagttccg
gcatga

DBGET integrated database retrieval system