KEGG   Gordonia bronchialis: Gbro_0934Help
Entry
Gbro_0934         CDS       T01102                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gbr  Gordonia bronchialis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gbr00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991664..992425
Genome map
AA seq 253 aa AA seqDB search
MTDDRALAGDLATAAGELLLDVRANSGLAGKELGRAGDLRSNDFLLERLRAQRPDDAVLS
EESADDKSRLSAPRVWIVDPVDGTREYGTEGRSDWAVHVALWSSSGGLIAGAVALPALGV
TYVDDAEPVEPVDGLAAEPKGETIRVVVSGSRPPAFSQAVADALGGEVLQMGSAGAKAMA
VVRGEADAYVHAGGQYEWDSAAPVAVARAKGLWCGRIDGSELVYNRDDTYLPDLVICRPE
FTDTIIGVTAPYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaccgcgcactggccggtgacctcgccaccgcagccggggaattgctgctc
gacgtgcgggccaactctggtctggccggcaaagaactcggccgggccggagatctgcgc
tccaatgactttctcctggaacggttgcgggcgcagcggcccgacgacgccgtgctctcc
gaggagtcggccgacgacaagtcgcggctgtccgccccgcgcgtctggatcgtcgacccc
gtcgacgggacccgtgagtacggcaccgaaggccgctcggattgggctgtgcacgtggcg
ctctggtcgtcctcgggtggactgatcgcgggtgcggtcgccctgcccgcgctcggtgtg
acctacgtcgatgacgccgaacccgtcgaacccgtggacgggctggccgccgaacccaaa
ggcgagaccatccgggtggtggtcagtggctcacgaccaccggcgttctcgcaggcggtc
gccgacgccctgggtggtgaggtcctgcagatggggtcggccggtgccaaggcgatggcc
gtggtgcgcggcgaagccgacgcctacgtccacgccggcggacagtatgaatgggattcc
gccgccccggttgcggtcgcccgggcaaaagggttgtggtgcgggcgaatcgacggttcg
gagttggtctacaaccgcgacgacacgtatctgccggacctggtgatctgccgtccagag
ttcaccgacaccatcatcggggtgacggcgccgtacgcgtga

DBGET integrated database retrieval system