KEGG   Gordonia bronchialis: Gbro_0934Help
Entry
Gbro_0934         CDS       T01102                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gbr  Gordonia bronchialis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Gbro_0934
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Gbro_0934
Transfer RNA biogenesis [BR:gbr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Gbro_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991664..992425
Genome map
AA seq 253 aa AA seqDB search
MTDDRALAGDLATAAGELLLDVRANSGLAGKELGRAGDLRSNDFLLERLRAQRPDDAVLS
EESADDKSRLSAPRVWIVDPVDGTREYGTEGRSDWAVHVALWSSSGGLIAGAVALPALGV
TYVDDAEPVEPVDGLAAEPKGETIRVVVSGSRPPAFSQAVADALGGEVLQMGSAGAKAMA
VVRGEADAYVHAGGQYEWDSAAPVAVARAKGLWCGRIDGSELVYNRDDTYLPDLVICRPE
FTDTIIGVTAPYA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgaccgcgcactggccggtgacctcgccaccgcagccggggaattgctgctc
gacgtgcgggccaactctggtctggccggcaaagaactcggccgggccggagatctgcgc
tccaatgactttctcctggaacggttgcgggcgcagcggcccgacgacgccgtgctctcc
gaggagtcggccgacgacaagtcgcggctgtccgccccgcgcgtctggatcgtcgacccc
gtcgacgggacccgtgagtacggcaccgaaggccgctcggattgggctgtgcacgtggcg
ctctggtcgtcctcgggtggactgatcgcgggtgcggtcgccctgcccgcgctcggtgtg
acctacgtcgatgacgccgaacccgtcgaacccgtggacgggctggccgccgaacccaaa
ggcgagaccatccgggtggtggtcagtggctcacgaccaccggcgttctcgcaggcggtc
gccgacgccctgggtggtgaggtcctgcagatggggtcggccggtgccaaggcgatggcc
gtggtgcgcggcgaagccgacgcctacgtccacgccggcggacagtatgaatgggattcc
gccgccccggttgcggtcgcccgggcaaaagggttgtggtgcgggcgaatcgacggttcg
gagttggtctacaaccgcgacgacacgtatctgccggacctggtgatctgccgtccagag
ttcaccgacaccatcatcggggtgacggcgccgtacgcgtga

DBGET integrated database retrieval system