KEGG   Gordonia bronchialis: Gbro_1016Help
Entry
Gbro_1016         CDS       T01102                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
gbr  Gordonia bronchialis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gbro_1016
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Gbro_1016
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbro_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081136..1082113
Genome map
AA seq 325 aa AA seqDB search
MAPVIRPRRLRSTAALRRLVAETTLAPRQLVLPMFVADGLDAPREISSMPGVLQHTVDSL
RKAADEAVRAGVGGLMLFGVPDEKDKDATGSGADADDGVLNRALRVLTDDLGDDTVLMAD
TCLDEFTDHGHCGVLDAAGRVDNDATLDRYVSMSLAQARSGARLLGPSGMMDGQVAAIRT
ALDDAGFTDTGILAYAAKYASAFYGPFREAVGSSLQGDRRTYQQDSANRIEALREVRLDL
DEGADIVMVKPAMSYLDIVRDVAEISDVPVAAYQISGEYSMITAAAERGWIDRDAAILES
LTSTRRAGASIILTYWATEVALRLS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccccggtgatccgcccgcgtcgactccggtcgacggccgccctgcgccgactggtg
gccgaaaccaccctggcgccaaggcaactggtgctgccgatgttcgtcgccgacggtctc
gatgccccgcgggagatctcgtcgatgcccggcgtgctccagcacaccgtcgactcgctg
cgcaaggccgccgacgaggcggtccgcgccggcgtcggaggtctgatgctcttcggggtg
ccggacgaaaaggacaaggacgcaacgggttcgggagccgacgctgacgacggcgtgctc
aatcgagcgttgcgtgtgctcaccgacgatctcggcgatgacaccgtcctgatggccgac
acctgcctggacgagttcaccgaccacggccactgcggcgtcctcgacgccgccggccgc
gtcgacaacgacgccaccctcgaccgctacgtctcgatgtcgttggcgcaggcgcgcagt
ggcgcgcggctgctgggaccgagcgggatgatggacgggcaggtcgccgcgatccgcacc
gcgctcgacgacgccgggttcaccgacaccggaatcctcgcctacgccgccaagtacgcg
tcggccttctacggaccgttccgcgaggctgtcgggtcgtctctgcaaggcgatcgtcgg
acctaccagcaggactccgcgaaccggatcgaggcattgcgcgaggtgcgcctcgacctc
gacgagggcgccgacatcgtcatggtgaaaccggccatgagctacctcgacatcgtgcgc
gacgtcgccgagatctccgacgtcccggttgccgcctatcagatctcgggcgagtactcg
atgatcaccgcggctgccgaacgcggctggatcgaccgggacgccgcgatcctggagtcg
ctgacctccacccgccgcgccggcgcatcgatcatcctcacgtattgggctaccgaggtg
gcgctccggttgtcctga

DBGET integrated database retrieval system