KEGG   Gordonia bronchialis: Gbro_1070Help
Entry
Gbro_1070         CDS       T01102                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gbr  Gordonia bronchialis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbro_1070
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Gbro_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128137..1129222)
Genome map
AA seq 361 aa AA seqDB search
MNRVFSMKNGTGGHWKRNMTLALLLVIVGSLAGCASPANDVGSTDHVRSSRVFENDPTLT
AQRTALPTRAFTATAFSQTRQWLRDHPHDPRTTALRAALGDKPDTLWLTGDSRDLPNLTS
MLATARSTGTTPVVVLYNIPGRDDGLTGPINNLTSTDYLTWVGGVASAIGNTSAIVIVEP
DSLWLADRQFRADRAGFDRRMQLLQKVVTRLNRNPGTYVYLDAGTSSGSVTPERMAALLR
GAGASERTGFAVNVSSFAPTAPITIYAQRIRAALIATGTPDPRYVVDTSRNGNPQWDNDT
WCNPPGRKIGYAPRANPPAAPPGLDAYLWVKAPGTSDGSCGVGQGSSGGDFLPAVAFAMT
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgtgttttccatgaagaacggtaccggggggcactggaaacgcaacatgaca
ctcgcacttctactcgtgatcgtcggatcgctagccggttgcgcgagtcctgcgaatgac
gtcggatcgacagaccacgtccgctcgtcacgcgttttcgagaacgaccccaccctcacc
gcgcaacgaacagcgctgcccacgcgcgctttcacggcgacggcgttcagccagacccgt
cagtggttgcgagaccatccccacgatccgcgcaccacggccctgcgcgcggcgctgggc
gacaaaccggataccttgtggctcaccggggattcgcgcgatctgcccaacctgacctcg
atgcttgcgacagcgcgcagtaccgggaccacgccggtcgtcgtcctgtacaacattccc
ggccgcgacgacggattgaccggtcccatcaacaatctcacttcgaccgactatctgacc
tgggtcggcggtgtcgcatccgcaatcggcaatacctcggcgatcgtcatcgtcgaaccc
gactcactatggttggccgatcgacagttccgggcggaccgtgccgggttcgacagacga
atgcaactgctacagaaggtagttacgcgcctcaaccgaaatcctggaacctacgtgtac
ctcgatgccggaaccagttcgggttcggtgacaccggaacgcatggcggcactgctgcgc
ggtgcaggcgcatccgaacggaccggattcgcggtgaacgtcagttcttttgccccgact
gcgccgatcaccatctacgcgcaacgcatccgcgcagctctgatcgctaccgggacgccc
gatccacgttacgtcgtggatacctcacgtaacggaaacccccagtgggacaacgatacc
tggtgcaatccgcccggacgcaagatcggctatgcacctcgtgcgaatccacccgcggcc
cccccgggtctcgatgcgtacctgtgggtgaaggcgccgggtacctcagacgggtcgtgc
ggtgtgggacaaggcagctcaggtggcgacttcctgcctgcggtggcatttgcgatgacg
cgctga

DBGET integrated database retrieval system