KEGG   Gordonia bronchialis: Gbro_1323Help
Entry
Gbro_1323         CDS       T01102                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gbr  Gordonia bronchialis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gbr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1385003..1385890
Genome map
AA seq 295 aa AA seqDB search
MPELPEVAAIADYVDSRAAGLPIRRVDVASLSVLKTADPPYTALVGRIVESVGRVGKYLV
IRTVPGADTDPEPVILLVIHLSRAGWLRWSEDLSPRPLRPGGKSPIALRVHCGLPSEGFD
VTEAGTQKRLAVWIVRDLADIDRVATLGPDVLSLSVSEFGAILAQTAGRIKNVLADQRVM
AGIGNAYSDEILHTARLSPFATAKSLTEEQVSTLYDAMRSVLADATGRLEGQTVARLKSE
KRTGLRVHARTGLPCPVCGDTVREVSFADRSFQYCPTCQTGGKVLADRRMSRLLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcttcccgaggtcgccgcgatcgccgactacgtcgactcgcgcgcggccggt
ctgcccatccgccgggtcgacgtcgcgtcgttgtcggtgctcaagaccgccgacccgccg
tacacggcactcgtcggacggatcgtcgaatcggtcggccgggtgggcaaatacctggtg
atccggaccgtccccggcgccgacaccgaccccgaaccggtgattctgctggtcatccac
ctgtcgcgggcgggctggctgcggtggagcgaggacctctcaccccggccgctacgtccg
ggcggcaaatcgccgatcgcgctgcgggtgcactgtggtcttccatcagaaggattcgac
gtgaccgaggcgggaacgcagaagcggctggcggtgtggattgtgcgtgacctcgccgac
atcgaccgcgtcgccaccctgggcccggacgtgttgtcgctgagcgtgtccgagttcggc
gccatcctcgcccagaccgccggacgcatcaagaacgtgctcgccgatcagcgtgtcatg
gccggtatcggcaacgcctactccgacgagatcctgcacaccgcccgactctcaccgttc
gcgacggccaagtcgctcaccgaggaacaggtgagcaccctctacgacgcgatgcgcagt
gtgctcgccgacgcgaccggccggctcgaggggcagacggtggctcggctcaagtcggag
aagcggaccggtctgcgggtccacgcccgcaccgggttgccgtgcccggtctgtggggac
accgtacgcgaagtgtcttttgccgaccggtccttccagtactgtccgacctgccagacc
ggtggcaaggtgctggccgaccgccgtatgtcgcggctgctgaagtag

DBGET integrated database retrieval system