KEGG   Gordonia bronchialis: Gbro_1341Help
Entry
Gbro_1341         CDS       T01102                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00020  Citrate cycle (TCA cycle)
gbr00640  Propanoate metabolism
gbr00660  C5-Branched dibasic acid metabolism
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbro_1341
   00640 Propanoate metabolism
    Gbro_1341
   00660 C5-Branched dibasic acid metabolism
    Gbro_1341
Enzymes [BR:gbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Gbro_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACY20628
UniProt: D0L671
Position
1407136..1408299
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHGVPTTPGRVTDDAADARAIAEEIGKPVMIKAQVKVGGRGKAGGVK
YAATPDDAQSHAENILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDEATARSIAEQGHLPAEVLDAAAVTIAKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDENADFRHPDHDEFADKDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMAAGLD
VILGDEQVKSVFVNVFGGITACDAVANGIVGALNKLGDEANKPLVVRLDGNKVEEGRKIL
ADANHPLVTLAETMDSGADKAAELASK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaggaactgttcgccaagcatggggttcccaccaca
cccgggcgggtgaccgatgatgccgccgatgcgcgggcgatcgccgaggaaatcggcaag
cctgtgatgatcaaggcgcaggtcaaggtcggcgggcgtggcaaggccggtggcgtgaag
tacgccgcaacccctgatgacgcacagtcgcacgccgagaacatcctgggccttgacatc
aagggccacgtcgtcaagaagctgctggtcgccgaggccagtgacatcgcggaggagtac
tacatctccttcctgctcgatcgtgcgaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgcgaccaagcccgagcgtctggccaaggtgccg
gtcgacgccgtcaagggtgtcgacgaggccaccgcccgctcgatcgccgagcagggccac
ctgcccgccgaggtgctcgacgccgcagcggtgaccatcgccaagctgtgggaagtcttc
gtcgccgaagacgcgaccctggtggaggtcaacccgctggtccgcacccccgacgatcag
atcctggccctcgacggcaaggtcaccctcgacgagaacgccgacttccggcatcctgac
cacgatgagttcgcggacaaggatgcgaccgatccgctggagctgaaggccaaggagaac
gacctcaactacgtcaagctcgacggacaggtcggcatcatcggcaacggcgcgggtctg
gtcatgtcgaccctcgacgtcgtcgcctacgcgggagaagcccacggcggcgtcaagccg
gccaacttcctcgacatcggtggcggcgcctcggccgaggtcatggccgcgggactcgac
gtcatcctgggcgacgagcaggtcaagagcgtcttcgtgaacgtcttcggcggcatcacc
gcctgtgacgcggtggccaacggcatcgtcggcgcgctcaacaagctcggcgacgaggcc
aacaagccgctcgtggtgcgcctcgacggcaacaaggtcgaggaaggccgcaagatcctg
gccgacgcgaatcacccgctggtgacgctcgccgaaacaatggactccggcgccgacaag
gccgccgagctggcgagcaagtga

DBGET integrated database retrieval system