KEGG   Gordonia bronchialis: Gbro_1413Help
Entry
Gbro_1413         CDS       T01102                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gbr  Gordonia bronchialis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Gbro_1413
   00052 Galactose metabolism
    Gbro_1413
   00500 Starch and sucrose metabolism
    Gbro_1413
   00520 Amino sugar and nucleotide sugar metabolism
    Gbro_1413
Enzymes [BR:gbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Gbro_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483094..1484038
Genome map
AA seq 314 aa AA seqDB search
MTSAAHSDEFTEYEAVPNTPPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELV
AEEAKAAGADRLLIITSPGKDGVVAHFVEDLVLENTLAKRGKAAMLAKVRKAPSLLEVAS
VVQEKPLGLGHAVGCVEQYLDDDEDAIAVLLPDDLVLPGGVLEVMARTRQRRGGSVLCAI
EVPGDRISAYGVFDVEELPDANNPNVKKLKGMVEKPEPADAPSNLAAAGRYILDRKIFDA
LRRIKPGAGGELQLTDAIALLIEEGEPVHVVVHRGTRHDLGNPGGYLKAAVDFALDRDDY
GPELREWLTKRLAE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgctgcacattccgacgagttcaccgagtacgaagccgtgccgaacacgccg
ccgatcccgcggaccgcggtggtcccggccgccggtctgggtacgcgcttcctgcccgcc
acgaagacggtgcccaaagagttgttgcccgtcgtcgacactcccggaatcgagctggtg
gccgaggaggccaaggccgccggcgccgaccgtctgctcatcatcacctcgcccggcaag
gacggtgtggtcgcgcacttcgtcgaggacctcgtcctggagaacaccctcgccaagcgc
ggcaaggccgcgatgctggccaaggtgcgcaaggccccctcgttgctcgaagtcgcgtcc
gtggtgcaggagaagccgctgggcctcgggcacgcggtcgggtgcgtggagcagtacctc
gacgacgatgaggacgccatcgccgttctgttgcccgacgacctggtgctgcccggcggc
gtgctcgaggtgatggcgcgcacccggcagcgtcgcggcggatcggtgctgtgcgcgatc
gaggtgcccggcgaccggatcagcgcctacggcgtcttcgacgtcgaggaactgcccgac
gccaacaacccgaacgtcaagaagctcaagggcatggtggagaagcccgagccggccgac
gcgccgtcgaacctggccgcggcgggccgatacatcctggaccgcaagatctttgacgcg
ctgcgccggatcaagccgggcgccggtggcgaattgcagctcaccgacgccattgcgctg
ctgatcgaggagggggagccggtgcacgtcgtcgtgcatcgcggtacccgccacgacctc
ggcaatccgggcggatatctcaaggcggccgtcgacttcgcgctcgaccgcgacgattac
ggccccgaactgcgggagtggctgaccaagcgtctcgccgaatga

DBGET integrated database retrieval system