KEGG   Gordonia bronchialis: Gbro_1518Help
Entry
Gbro_1518         CDS       T01102                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00900  Terpenoid backbone biosynthesis
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01130  Biosynthesis of antibiotics
Module
gbr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gbro_1518
Enzymes [BR:gbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Gbro_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACY20793
UniProt: D0L708
Position
1582872..1583819
Genome map
AA seq 315 aa AA seqDB search
MSPASLSVVSDSVTARAPSKVNLHLGVGPRRPDGYHDLVTVFQALSLHDDVRVSPGTDLT
VSVRGEGASAVPDDSSNLAARAVQALAEWCGRSPVAAIDIDKSIPVAGGMAGGSADAAAA
LVAAAAMWKLDVDRDDLSDIAAGLGSDVPFALHGATALGTGRGEQLISVLSRGEFHWVLA
LAREGLSTPQVYAELDRLRDNRSDDAMTDDPLRRPDDLMQALAAGDPRAVAPLLHNDLQP
AALSLQPALRRTLRAGVDAGALNGIVSGSGPTCAFLCLDEGSAVNVAAELSGAGVARSVR
TASGPVPGTRVISPD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcccgcgtcgctgtcggtggtttccgactccgtcaccgcgcgggctccgtcgaag
gtcaatctgcacctgggcgtgggtccgcgccgccccgacggctaccacgacctggtcacc
gtcttccaggctctgtccctgcacgacgacgtccgggtgtcaccgggcaccgacctgacg
gtgagcgtgcgcggtgagggcgcatccgcggtgcccgacgactcgtccaacctcgccgcc
cgggcggtgcaggcgctcgccgagtggtgcggacgcagccccgtcgccgcgatcgacatc
gacaagtcgatcccggtggccgggggaatggccggcggcagcgcggacgccgcggcggca
ctggtggcggcggcggccatgtggaaactcgacgtcgaccgtgacgatctgtcggatatc
gccgccggcctgggcagcgatgtcccgttcgcgctgcacggcgccaccgcactcggtacc
gggcgcggtgagcagctgatctcggtgctctcgcgcggcgagttccactgggtactcgcc
ctcgcccgcgagggcttgtcgaccccgcaggtctacgcggagctggatcgattgcgcgac
aacagatccgacgacgcgatgaccgacgatccgctgcgtcgccccgatgacctgatgcag
gcgctggccgccggcgacccgcgtgcggtggccccgctgctgcacaacgatctgcagccg
gccgcgctgagtctgcaaccggcacttcggcggacgctgcgcgccggggtcgacgccggc
gcgctgaacggcatcgtctcgggctctggaccgacctgtgccttcttgtgcctcgacgag
gggtccgctgtgaacgtcgccgccgaactgtccggcgcgggtgtcgcacgatcggtacgc
acggcgtcgggcccggtccccggcacgcgggtgatcagcccggactga

DBGET integrated database retrieval system