KEGG   Gordonia bronchialis: Gbro_1540Help
Entry
Gbro_1540         CDS       T01102                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
gbr  Gordonia bronchialis
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gbro_1540
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Gbro_1540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606573..1607013
Genome map
AA seq 146 aa AA seqDB search
MTSRTPIEITTAYLDALARDDIDAAMANLDDDIVYTNVSLPTVHGKRKVAKIFGGMATNP
RAGFNYRMINVSADGPVVLTERVDEISVGRVAVQFWVCGRFEIADGRIVVWRDYFDYFDC
TKALLHGLAAAVVPRLQRPLPVRVAA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgcaccccgatcgagatcacgacggcctacctcgacgccctcgcccgcgac
gacatcgacgccgcgatggccaacctcgacgacgacatcgtctacaccaacgtctcgctg
ccgactgtgcacggaaaacggaaggttgccaagatcttcggcggcatggccaccaacccc
cgcgcgggcttcaactaccgcatgatcaacgtcagcgccgacggtccggtggtcctgacc
gaacgcgtcgacgagatcagcgtcggccgcgttgccgtgcagttctgggtctgcggccgg
ttcgagatcgccgacgggcggatcgtggtgtggcgcgactacttcgactacttcgattgc
accaaggcgctgctgcatggtctggccgccgccgtggtgccgcggctgcagcgcccgctc
ccggtgcgcgtcgcggcctga

DBGET integrated database retrieval system