KEGG   Gordonia bronchialis: Gbro_1728Help
Entry
Gbro_1728         CDS       T01102                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gbr  Gordonia bronchialis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Gbro_1728
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Gbro_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802461..1804224
Genome map
AA seq 587 aa AA seqDB search
MAAHHEPTHFDVLIIGSGFGGSVSALRLVEKGYRVGVIEAGRRFEDEDFAKTSWRLNKWL
WAPKLGLYGIQRIHALKDVMILAGAGVGGGSLNYANTLYKPPTPFFTDPQWRDITDWSDE
LSPYYEQARRMLGVVTNPTVTESDRVMREVAEEMGAADTFTATPVGVFFGAKTGFAGEPG
QKVPDPYFGGVGPERTACTECGACMTGCRVGAKNTLMKNYLGLAERAGAIIIDRTTVQSL
EQSSDGTWLVGTHRSSSWGPVGRRARTFTAGQVIVAAGTFNTQRLLHHAKHSTLPQISDA
MGVLTRTNSESILGAAASHYDPRHDYSHGVAITSSFHPDPTTHIEPVRYGKGSNAIAYLQ
TLLTDGGTRANRFGQFLRQVARNPLLLVRLLVVRKWSQRTVIALVMQNNNNSLTTFVRKR
GPFRYITSKQGHGEPNPTWIPKGNEATRRIASKLPGGMAGGTWGDIMNMPLTAHYLGGCA
ISDDPATGVIDAYHRVWNYPTLHVTDGAAVSANLGVNPSLTICAQAERAMALWPNKGEQD
MRPAQGRPYERISPCPPVAPVVPAQAPGALRLPITPVEHLAERTSVG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccaccatgaacccacgcacttcgacgtgctcatcatcggatccggtttcggc
ggcagtgtcagcgcgctgcgtctggtcgagaagggataccgggtcggcgtcatcgaggcc
ggacggcgcttcgaggacgaggatttcgcgaaaaccagctggcgactgaacaagtggctc
tgggcacccaagctcggcctctacggcatccagcgcatccacgcgctcaaggacgtcatg
atcctcgcgggcgccggggtcggcggcgggtcactcaactacgccaacaccctctacaag
ccgcccaccccgttcttcaccgacccgcagtggcgcgacatcaccgactggtccgacgaa
ctgtcgccctactacgagcaggctcggcgcatgctcggcgtggtgaccaatccgacggtg
accgagtcggatcgggtgatgcgcgaggtggccgaggagatgggggcggccgacaccttc
accgcgacgccggtcggggtgttcttcggtgcgaaaacgggtttcgcaggtgaacccggt
cagaaggtgcccgacccgtacttcggtggcgtcggaccggagcgcaccgcctgcaccgaa
tgcggcgcctgcatgaccggttgccgggtgggcgccaagaacaccctcatgaagaactat
ctgggtctggccgaacgtgccggcgccatcatcatcgatcggacgaccgtacagagcctg
gagcagtcatccgacggcacgtggctcgtgggcacccatcgttcctcgtcctggggtccg
gtgggccgccgggcgcgtaccttcaccgccggccaggtgatcgtcgcggccggtaccttc
aacacccagcgtctgcttcatcacgcgaaacattcgacgctgccgcagatctcggacgcg
atgggtgtgctcacgcgcaccaactccgaatccatcctgggtgcggccgcgagccactac
gacccgaggcacgactactcgcacggtgtcgcgatcacgtcgtcgtttcacccggatccg
accacccacatcgaacccgtccgatatggcaagggctccaacgcgatcgcctatctgcag
accctgctcaccgacggtggtacccgggccaaccggttcgggcagttcctacgtcaggtg
gcccgcaatccgctgctgctggtgcgacttctggtggtgcgcaaatggagtcagcgcacc
gtcatcgccctggtcatgcagaacaacaacaactcgttgaccaccttcgtgcgcaagcgg
ggaccgttccggtacatcaccagcaaacagggtcacggcgaacccaacccgacctggatt
cccaagggcaatgaggccactcgccgcatcgcgagcaagctgccgggcggaatggcgggc
ggcacctggggtgacatcatgaacatgccgctcaccgcgcattatctcggcgggtgcgcc
atctccgacgacccggccaccggcgtcatcgacgcctatcaccgggtgtggaactacccg
acactgcacgtcaccgacggcgcggcggtctcggccaacctcggggtcaatccgtcgctg
accatctgcgcgcaggccgaacgcgcaatggcgttgtggcccaacaaaggtgagcaggat
atgcggcccgcacagggtcgaccctacgagcggatcagcccatgcccgccggtcgcgccg
gtggtccccgcacaggcgcccggtgcgctgcggctgcccatcacgcctgtcgagcatctc
gccgagagaacatccgtcgggtga

DBGET integrated database retrieval system