KEGG   Gordonia bronchialis: Gbro_1780Help
Entry
Gbro_1780         CDS       T01102                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
gbr  Gordonia bronchialis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Gbro_1780
Enzymes [BR:gbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Gbro_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1856527..1857840
Genome map
AA seq 437 aa AA seqDB search
MIRDDEVIHAVSVIAAKRDAHELSDAQISWVIDAYTRGEVAAEQMSSLLMAIVLRGMGRR
EIASWTRAMIDSGRRVDLSGLRRDGRPLVTVDKHSTGGVGDKITLPLTPLVASFGVAVPQ
LSGRGLGHTGGTLDKLEAIPGWRSDLSGDEMVAQLEGVGAVVCAAGADLAPADRMLYALR
DVTGTVESIPLIASSIMSKKIAEGTGALVLDVKFGAGAFLPDVEDARSLAETMVELGTDA
GVRTSALLTDMNTPLGRAVGNAVEVAESLKVLDGGGPADVVELTLALAREMLDAAGLSAA
DPAEHLANGRAMDSWRAMIAAQGGDPDGSLPIARHQEVVTAPAEGVIVSMDARAVGDAAW
RLGAGRSRPGESVQAEAGVIIHAKPGDRVRTGDALFTLHTQTPERVAGARSALVDAVVVG
TDREVTPGPRVLDRVTA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgacgacgaggtcatccacgccgtctcggtcatcgcagccaaacgcgacgca
cacgagctcagcgatgcccagatctcctgggtgatcgatgcgtacacccgcggtgaggtg
gccgccgagcagatgtcgtcgttgctgatggccatcgtgctgcgcgggatgggtcggcgc
gagatcgcgtcctggacgcgggcgatgatcgacagtggccgccgggtcgacctgtccggc
ctgcgtcgcgacggccggcccctggtgaccgtcgacaagcactcgacgggcggggtgggt
gacaagatcacccttccgctcaccccgctggttgcgtccttcggggtcgcggtgccgcag
ctgtccggccggggactcggccacaccggcggcacactggacaaactcgaggccatcccc
gggtggcggtccgatctgtccggcgacgagatggtcgcccagctcgaaggcgtgggggcc
gtggtgtgcgcggccggcgccgatctggctcccgccgaccgcatgctctacgcgctgcgc
gatgtgaccggcaccgtcgaatccatcccgctcatcgccagttcgatcatgagcaagaag
atcgccgagggaaccggcgcgctggtgctggacgtgaagttcggggcgggggcctttctg
cccgacgtcgaggacgcgcgcagcctcgccgagacgatggtggagctcggtacggatgcc
ggagtgcggacaagtgccttgctcaccgacatgaacacgccgttgggccgagccgtcggg
aacgcggtcgaggtcgccgaatcgctgaaggtgctcgacggtggtggcccggccgacgtg
gtggagctgacgctggcgctggcccgcgagatgctcgacgcggccggtctgtctgcggcc
gatccggccgagcatctggccaacgggcgagccatggattcctggcgcgccatgatcgcc
gcgcagggcggtgacccggacgggtcactcccgattgcgcggcaccaggaggtcgttacc
gcaccggccgagggcgtcatcgtgtcgatggacgcgcgggccgtcggcgatgcggcctgg
cggctcggtgccggccggtcccggccaggtgagtcggtccaggcggaggcgggtgtgatc
atccacgccaaaccgggcgatcgggtgcggacgggcgacgcgctgttcaccctgcacacc
cagacgccggaacgggtggccggtgcccggtcggcgctcgtcgatgccgtcgtggtcggc
acggaccgcgaggtcacccccgggccgcgcgtgctcgatagggtgacggcatga

DBGET integrated database retrieval system