KEGG   Gordonia bronchialis: Gbro_1798Help
Entry
Gbro_1798         CDS       T01102                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gbr  Gordonia bronchialis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Gbro_1798
Enzymes [BR:gbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Gbro_1798
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbro_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1873766..1875274)
Genome map
AA seq 502 aa AA seqDB search
MSSSETYVAAIDQGTTSTRAMVFDRGGRVVSSEQIEHEQIFPRAGWVEHDAMEIWRNTRR
VAAAALASADLKYGDIAACGLTNQRETTVIWDRETGEPIHNAIVWQDTRTGDLCRELAGD
DGPGRYRDQTGLPLSTYFAGPKARWILDHVDGSRERAENGELCFGTMDSWIAWNMTGGRD
GGLHITDVTNASRTMLMDLRTLSWDEALCDAFGVPVAMLPEIHSSAEVYGPLREHGSLPG
VPLAGILGDQQAATFGQACLEPGEAKNTYGTGNFLLLNTGTEPVFSDHGLLTTVCYRIGD
QPARYALEGSIAVTGSLVQWLRDNLGLFPHASDIEELAAQVHDNGGAYFVPAFSGLFAPR
WRSDARGVIVGLTRFVNKGHIARAALEASAFQTREVIEAMQADSGVELSTLKVDGGMVVN
DLLMQFQADILDVPVVRPVVNETTALGAAYAAGLAVGYWDSEDEIRANWAEDKRWEPTID
SAERDRLYSEWNRAVEHSFDLA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagctcagagacctatgtggccgcgatcgatcagggcaccacgtcgaccagggcg
atggttttcgaccgtggcgggcgcgtcgtcagttccgagcagatcgaacacgagcagatc
ttcccccgggccggctgggtggagcacgatgcgatggagatctggcgcaatacgcgccgc
gtcgcggctgccgcgctggcatcggccgatctcaaatacggcgacatcgcggcatgcggc
ctgaccaatcagcgcgagacgacggtgatctgggaccgcgaaaccggtgagccgatccac
aatgccatcgtctggcaggacacccgcaccggggacctgtgccgcgagctcgccggcgac
gacgggcccggccgctaccgcgaccagaccggtctgccgctgtcgacgtacttcgccggc
cccaaggcacggtggatcctcgaccacgtcgacggatcgcgcgagcgtgccgagaacggc
gaattatgcttcggcacaatggattcctggatcgcctggaacatgaccggtggtcgcgac
ggcggtctgcacatcaccgatgtcaccaatgcctcgcgcaccatgctgatggatctgcgc
accctgtcgtgggacgaggcactgtgcgacgccttcggcgtcccggtggccatgctgccc
gaaatccacagttccgcagaggtttacggaccgctgcgcgagcacggatcgctacccggg
gtaccactcgccgggattctgggcgaccagcaggcggcgaccttcgggcaggcctgcctg
gaacccggcgaggccaagaacacctacggcaccggaaacttcttgttgctcaacaccgga
acagagccggtgttcagcgatcacggcctgctcaccacggtctgttaccgaatcggcgac
caaccggcgcgctacgccctcgaaggatccatcgccgtcaccggctccctggtgcaatgg
ctccgcgacaacctgggactctttccgcacgccagcgacatcgaggagttggccgcacag
gtccacgacaacggcggcgcctacttcgtgccggcgttctccggactgttcgccccccgg
tggcgttccgacgcccgcggcgtcatcgtcggcctgacccgctttgtcaacaagggacat
atcgcccgagccgccctggaggccagcgcttttcagacccgcgaggtcatcgaggccatg
caagcggattccggtgtggaactgtcgaccctcaaggtcgacggcgggatggtcgtcaac
gacctcctcatgcagttccaggccgacatcctcgacgtccccgtcgtccgcccggtcgtc
aacgagaccaccgcactcggcgccgcctacgctgccggcctggccgtcggctactgggac
agcgaggacgagatccgcgccaactgggccgaggacaaacgctgggaacccaccatcgat
tccgcggaacgcgaccggttgtatagcgaatggaaccgcgcagtcgagcacagtttcgac
ttggcctga

DBGET integrated database retrieval system