KEGG   Gordonia bronchialis: Gbro_1902Help
Entry
Gbro_1902         CDS       T01102                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbro_1902
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_1902
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Gbro_1902
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Gbro_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996457..1997539
Genome map
AA seq 360 aa AA seqDB search
MTEATGPVHSGWPGLIEAYRSRLPVGDDWKVVTLLEGGTPLISAPHLSEITGCEVYLKVE
GLNPTGSFKDRGMTMAVSNAVNNGKTAVLCASTGNTSASAAAYATRAGITCAVLIPEGKI
AMGKLAQAVMHGAKIIQVQGNFDDCLELARKATAEFTEIELVNSVNPARIEGQKTASFEI
VDVLGRAPDVHALPVGNAGNITAYWKGYKEYHADGVADRLPRMLGVQAAGAAPLVNGAPV
KEPETIATAIRIGSPASWNQAVAAKEESDGRFLAATDEKLLEAYRLIAGREGLFVEPASA
ASVAGLLAARTEGWVREGQTVVCTVTGNGLKDPDTALSGMPEVEAIPVDPVAVADALGVA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcgactggacccgtgcacagcggctggcccgggctgatcgaggcataccgt
tcgcggctgcccgtcggagacgactggaaggtcgtgaccctgctggagggcgggaccccg
ctgatcagcgcgccccatctgtccgagataaccggctgcgaggtctacctcaaggtcgag
ggcctcaacccgaccggatcgttcaaggaccgcgggatgacgatggcggtcagcaatgcg
gtcaacaacggcaagaccgcggtgctgtgcgcatccaccggcaacacgtcggcatcggca
gcggcgtatgccacccgcgccggcatcacctgcgcggtgctgatccccgagggcaagatc
gcgatgggcaaactggcccaggcggtcatgcacggtgccaagatcattcaggtgcagggc
aacttcgacgactgcctggaactcgcccgcaaggcgaccgcggagttcaccgagatcgaa
ttggtcaactcggtcaatccggcgcgcatcgagggacagaagacggcctcgttcgagatc
gtcgacgtgctgggccgcgcccccgacgtgcacgcgctgccggtcgggaacgcgggcaac
atcaccgcgtactggaagggctacaaggagtaccacgccgacggtgtcgccgaccggctg
ccgcgcatgctgggcgtgcaggccgccggtgcggctccgctggtcaacggggcgccggtg
aaggagccggagaccattgccaccgcgatccgtatcgggtcgccggcgagctggaatcag
gccgtggcggccaaggaagaatccgacggacggttcctggcggcgaccgacgagaaactc
ctcgaggcttatcggctgatcgcgggtcgggaaggcctgttcgtggagccggcgtcggcg
gccagtgtcgccggcctgctggcggcgcgcaccgagggctgggtgcgggagggtcagacc
gtcgtctgtaccgtcaccggcaacggtctcaaggaccccgacaccgcgctgtcggggatg
cccgaggtggaggcgatcccggtggacccggtggcggtggcagatgcactcggcgtggcc
tga

DBGET integrated database retrieval system