KEGG   Gordonia bronchialis: Gbro_1945Help
Entry
Gbro_1945         CDS       T01102                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
gbr  Gordonia bronchialis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_1945
   00330 Arginine and proline metabolism
    Gbro_1945
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Gbro_1945
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Gbro_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052176..2053627
Genome map
AA seq 483 aa AA seqDB search
MASHVGGYLRHIMDTCAQNRSGQVADYIPELAAVDPDGYGLSLCVHDGHTYSCGDSDHEF
TIQSVSKPLTYAMVLSRLGAVAADPKIGVEPSGEAFNEISVDARRRPRNPMINAGAIMSA
SLLLPPVRDVAESVIVSTFAEIVDFYSACAGRRLTMDEAVYTSESRTGSRNRAIAYMLDS
FGTLDTSPDAALDLYYRQCSIRVTTDDLAVIAATIANGGLNPRTGRHVFNQEVAQRVLSV
MTTCGMYDGAGDWVTSVGLPAKSGVGGAIMAVLPGQLGIGVYSPRLDEHGNSVRGGETCR
HLSTDLGLHMFNVTRESRVTIRAVYDISDVPVGTEWSEQERGFLRTCRDRVRVYELQGDL
TFGGAESALRRLETDMDDFVVAIVEISRIGVIDPVARTMILSMKRTLEERGRQAMLVDPD
GVMRDSVDRHRHDAIAPDLNVPEDLRGLDPTLPHVHATMDAAVADAEEFLLKRARDETVR
DSG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcctctcacgtcggcgggtatctccgtcacatcatggacacctgtgcccagaaccgg
tcgggacaggttgccgattacatcccggaactggcggccgtcgacccggacggttacggg
ctctcgctgtgcgtgcacgacgggcacacctactcgtgcggcgacagcgaccacgagttc
accatccagtcggtctcgaaaccgctgacctatgcgatggtgctcagtcgtctcggcgcg
gtggccgcggaccccaagatcggtgtggaaccgtccggggaggcgttcaacgagatcagc
gtcgacgcccggcgccgcccacgtaacccgatgatcaacgccggcgccatcatgtcggcg
tcgttgttgctgccgccggtccgcgacgtcgccgagagcgtgatcgtttccacctttgcc
gagatcgtggatttctactcggcctgcgccggccggcggctcacgatggacgaggccgtc
tatacctccgagtcgcggacggggtcccgcaatcgcgcgatcgcctacatgctggacagc
ttcggaaccctcgacaccagcccggatgccgccctcgacctgtactaccggcagtgctcg
atccgggtgaccaccgacgatctcgcggtcatcgccgccaccatcgccaacggcggactc
aacccgcgcaccggtcggcacgtcttcaatcaggaagtggcccagcgggtgctgtcggtg
atgaccacctgcggcatgtatgacggtgccggtgactgggtgaccagtgtcgggttgccg
gccaagagcggtgtcggcggggcgatcatggcggtcctgccgggacagctcgggatcggg
gtgtactcaccgcggctcgacgagcacgggaacagtgtgcgcggtggcgagacatgccgg
catctgtcgaccgacctggggctgcacatgttcaacgtcacccgggagagccgggtgacc
atccgggcggtctacgacatcagcgacgtcccggtcggcacggagtggtccgagcaggag
cgggggttcctgcgcacgtgccgcgatcgggtgcgcgtctacgaactccagggtgatctg
accttcggcggcgcggagagcgcactgcgtcggctcgagaccgacatggacgactttgtg
gtggccatcgtcgagatctcgcggatcggggtgatcgacccggtggcccgcacaatgatc
ctcagcatgaagcgcaccctcgaggagcgggggcgccaggcgatgctcgtcgatccagac
ggcgtgatgcgcgacagcgtcgaccgtcatcgccacgacgcaatcgcgccggatctcaat
gtgccagaggaccttcgcgggctcgaccccactctgccgcacgtgcacgcgacgatggac
gccgcggtggccgacgcggaagaatttctgctcaagcgcgcccgggacgaaacggttcgc
gactcgggctag

DBGET integrated database retrieval system