KEGG   Gordonia bronchialis: Gbro_1955Help
Entry
Gbro_1955         CDS       T01102                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gbr  Gordonia bronchialis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbro_1955
Enzymes [BR:gbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Gbro_1955
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Gbro_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2061144..2063369)
Genome map
AA seq 741 aa AA seqDB search
MTETSAPEPSAPEPFASDHDLRRLFALTHPDPHAFLGAHDAPGGHTILRTLRPDAISVTA
VIGGVDHPMQRQTDDLFVATVPIDGLIDYRYRVVYPAGDGGTAEYLVADGYRFLPSLGEM
DEHLFAEGRHEALWKILGARVVSYTTPDGEVVGTAFSVWAPNAHGVVVIGDFDAWAGRLA
PMRAIGSSGIWEVFVPDVGDGAAYKFRIHGADGVIREKADPMAFRTTHPPATASVVSVSD
YEWGDDAWIARRAESTPAAEPMSVYEVHMASWRAGLDYRAMAHELADYVTEKGFTHVEFL
PVAEHPFGGSWGYQVTSYYAPTARFGTPDDFRYLVDHLHSQGIGVLVDWVPAHFPKDDWA
LARFDGTPLYENADPMRGEQLDWGTYVFDFGRHEVRNFLVANALYWIDQFHIDGLRVDAV
ASMLYLDYSRPEGGWRPNVYGGRENLEAVQFLQEMNATVHKHFPGIVTVAEESTAWPGVT
RMTDLGGLGFSFKWNMGWMHDTLGYFGRDQVHRSFHHHEITFSLMYAWSENFVLPISHDE
VVHGKGTLWSRMPGNSFVKAAGVRNLLAYMWSHPGKQLLFMGQEFGQTGEWADNRSLDWH
QLEGWEGELHAGISTLVTDLNRVYRSSPALYSQDTDPLGYEWIDANDTANNVISFLRFGS
DGSMVACLFNFSGADRDSYQVGLPKDGVWEEILNTDAEAYAGAGRGNMGVVTADGPSWHG
RPASARVMLPANSAIWLAPKG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagacatccgcaccggagccatctgcaccagagccgttcgcatccgaccacgac
ctacgcaggctcttcgccctgacccaccccgacccgcacgcctttctcggcgcgcacgac
gcgccgggcggccacacgatcctgcggacgctgcgtcccgacgcgatctcggtgaccgcg
gtcatcggtggcgtcgaccacccgatgcaacgacagaccgacgatctgttcgtcgcgacg
gtgccgatcgacggtctcatcgactatcgctaccgcgtggtctacccggccggcgacggt
ggcaccgccgagtacctggtcgccgacggctaccggttcctgccgagcctgggtgagatg
gacgaacacctattcgccgagggacggcacgaggcgttgtggaagatcctgggcgcccgc
gtggtctcctacaccacgcccgacggcgaagtcgtcggcactgccttctcggtctgggct
cccaacgcacacggcgtagtggtcatcggcgacttcgacgcctgggccggtcggctcgca
ccgatgcgggccatcggcagcagcggaatctgggaggtgttcgtccccgacgtcggcgac
ggcgccgcctacaagttccgcatccacggtgccgacggcgtgatccgcgagaaggccgat
ccgatggcattccggaccacccacccaccggccaccgcctcggtggtgagtgtctccgac
tacgaatggggcgacgacgcctggatcgcccggcgcgccgaatcgaccccggcggccgag
ccgatgagcgtctacgaagtccacatggcgtcctggcgggccggcctggactatcgtgcg
atggcccacgaactcgccgactacgtcaccgagaaggggttcacccacgtcgagttcctg
cccgtcgccgagcatcccttcggcgggtcgtggggctatcaggtcacctcgtactacgcg
ccgaccgcacggttcggcacacccgacgacttccgctacctcgtcgaccatctccactcg
cagggcatcggtgtgctcgtggactgggtgcccgcccacttcccgaaggacgactgggcg
ctcgcccgcttcgacggcaccccgctatacgaaaacgccgacccgatgcgtggtgagcag
ctggactggggcacatacgttttcgacttcggacgccacgaggtacgcaacttcctggtg
gccaacgcgctgtactggatcgatcagttccacatcgacggcctgcgcgtcgacgcggtc
gcgtcgatgctgtacctggactactcccggcccgagggcggatggcgtcccaacgtctac
ggcggccgcgagaacctcgaggccgtgcagttcctacaggagatgaacgcgacggtccac
aaacacttccccggcatcgtgaccgtcgccgaggaatcgacggcgtggccgggtgtcacc
cggatgaccgatctgggcgggctgggtttcagcttcaaatggaacatgggctggatgcac
gacactctgggttatttcggccgtgatcaggtgcaccgcagcttccatcatcacgagatc
acgttctcgctgatgtacgcctggagcgagaactttgtcctgccgatcagtcacgacgag
gtggtccacggcaagggaacgctgtggtcgcgcatgcccggcaactccttcgtcaaagca
gccggcgtccggaacctgttggcctacatgtggtctcatcccggcaagcagctgttgttc
atgggtcaggagttcgggcagaccggcgaatgggccgacaatcggagcctggactggcac
cagctcgagggctgggagggtgaattgcacgccgggatctcgacgctggtcaccgacctc
aaccgcgtctaccgcagctcaccggccctctacagccaggacacagatccgctgggctac
gagtggatcgacgccaacgacaccgccaacaacgtcatcagcttcctgcgcttcggctcc
gacggctcgatggtcgcctgcctgttcaacttctccggcgccgaccgggacagctatcag
gtcggcctcccgaaagacggtgtgtgggaggagatcctgaacaccgacgccgaggcgtac
gccggcgccggccgcggcaacatgggtgtcgtcaccgccgacggcccgtcgtggcacgga
cgtccggcgtcggcacgggtcatgctgccggcaaactcggcgatctggctggcgcccaag
ggctga

DBGET integrated database retrieval system