KEGG   Gordonia bronchialis: Gbro_1958Help
Entry
Gbro_1958         CDS       T01102                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gbr  Gordonia bronchialis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gbr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2067629..2068234)
Genome map
AA seq 201 aa AA seqDB search
MSTTDDRDRPGDVLIVVDVQNDFCEGGALGVDGGTAVAGAVTTLLPEYRTVVATRDYHIE
PGDHFSDDPDYVDSWPPHCRVGTDGVAFHPAFDAGRADEVFSKGEYSAAYSGFEGATADG
TTLSSWLRAAGAKRVDVVGIATDHCVRATALDAAEAGFTTRVLLNFTAAVAAETTRSALA
EMREAGVELVGDLLYDGASRS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaccgatgaccgcgaccgtccgggcgacgtgctgatcgtcgtcgacgtgcag
aacgacttctgtgagggcggcgcgctcggcgtcgacggcggtactgctgtcgccggcgcc
gtcaccacgctgctgcccgagtaccgcaccgtcgtcgccacccgcgactatcacatcgag
ccgggtgatcatttctccgacgaccccgattacgtggactcctggccgccgcattgccgc
gtcgggaccgacggcgtcgccttccatcccgccttcgacgccggccgcgccgacgaggtg
ttctccaagggcgagtacagcgccgcctactccggattcgaaggcgccacggccgacggg
accacactgtcgtcctggttgcgtgctgccggcgccaaaagggtcgacgtcgtcgggatc
gcgacggaccattgtgtccgcgccaccgcgctcgacgccgcggaggcgggcttcaccacc
cgcgtgctcctgaacttcactgccgcagtggctgccgagaccacccggtcggccctggcc
gagatgcgcgaagccggcgtggaattggtcggtgatctgctctatgacggtgcgagccgt
tcctga

DBGET integrated database retrieval system