KEGG   Gordonia bronchialis: Gbro_2062Help
Entry
Gbro_2062         CDS       T01102                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gbr  Gordonia bronchialis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gbr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192285..2193400
Genome map
AA seq 371 aa AA seqDB search
MSEVREFIARARSVVVKIGSSALTDLGTGLDTARLDRLADALEARMRAGSDVIVVSSGAI
GAGIAPLGLKKRPTDLATKQAAASVGQLALAHAWGTSFARYRRTVGQVLLTADDISNRAH
HANAQRTLDRLRSLGAVAVVNENDTVATNEIRFGDNDRLAALVAQLAGADALVLLSDIDG
LYDGDPRKVSPSGQPARFISEVAGPEDLDGVIAGAGGALGTGGMASKLAAARLAADSGVP
VLLAAASQAGQALSDASVGTVFAARPERLSARRFWVRHAADARGQIVLDDGAVTAVACRR
RSLLAAGVVGVRGRFSNGDVVELVDVNGIARARGVSAYDADDIAKMVGRSTSELPAELRR
AVVHADDLVAI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggtacgtgagttcatcgcgcgcgcccgcagcgtcgtcgtgaagatcggatcg
tcggcgctcaccgatctcggaaccgggctcgacaccgcgcggctcgaccggctcgccgac
gcgctggaggcacggatgcgggccggctccgacgtcatcgtcgtgtcgtccggtgcgatc
ggtgcgggcatcgccccgctgggactcaagaagcgacccaccgatctggccaccaaacag
gcggccgccagcgtcgggcagctcgccctggcccacgcctggggtacctccttcgcccgc
tatcgacgcacggtggggcaggtgctgctgaccgccgacgacatttccaaccgtgcccat
catgcgaatgcgcaacgcacacttgaccgtttgcggtcgctcggtgctgtcgcggtggtc
aacgagaacgacacggtggccaccaacgagatccggttcggcgacaacgatcgcctcgcg
gcgctggtcgcccagctcgccggggccgacgcactggtcctgctgtctgatatcgacggt
ctctacgatggcgatccgcgcaaggtctccccgtcggggcagccggcccgcttcatttcc
gaagtggcgggtcccgaggatctcgacggcgtgatcgccggggccggtggagcactgggt
accggtggtatggcctcgaaactggctgctgcgcgactggcggccgattccggtgtgccg
gtgctgctggcggccgcatcgcaagcggggcaagcgctttcggacgcatcggtagggacg
gtctttgccgcccggcccgaacggctctcggcacggcggttctgggtgcgtcatgccgct
gacgcgcggggacagatcgtgctcgacgacggcgcggtgaccgcggtggcgtgtcgtcgg
cgctcgttgctggccgccggcgtagttggtgtgcggggccgattctccaacggcgacgtc
gtcgaactcgtcgatgtcaacgggatcgcgcgtgcccgaggcgtttccgcctacgacgcc
gacgacatcgcaaagatggtgggccgctccacatctgagctgccggccgagttacgcaga
gctgtggtgcacgcggacgacctggtcgcgatctga

DBGET integrated database retrieval system