KEGG   Gordonia bronchialis: Gbro_2117Help
Entry
Gbro_2117         CDS       T01102                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00900  Terpenoid backbone biosynthesis
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01130  Biosynthesis of antibiotics
Module
gbr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Gbro_2117
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Gbro_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Calici_MSP
Motif
Other DBs
NCBI-ProteinID: ACY21366
UniProt: D0LAQ3
Position
2245831..2247015
Genome map
AA seq 394 aa AA seqDB search
MVQNGGVPTRVLILGSTGSIGVQALEVIREHPDRFRVVGLGAGGSNAALLTAQATEFGIG
PDRIAVADPVAAHQLADDLGGPVIAGPDAMCELIDSVEADVILNAVVGSIGLAPSLAALR
TGARLALANKESLVAGGSLVLDAAAPGQIVPVDSEHSAIAQCLRAGSADEVDRLVLTASG
GPFRGWTRAQLEDVTPEQAGRHPTWSMGPMITLNSATLVNKALEVIEAHLLFGVDYDHID
VTVHPHSIVHSMVTFVDGATVAKASPPSMKLPIALALGWPDRVPGSSSACDFSTAAQWTF
EPVDNEVFPAIDLARDAGRAGGSMTAVFNAANEAAAAGFFDGVIRFPRIVEIVAEVLGEA
DQWSSAPGSVEEVFAADQWARDRAAVLVLDGVST
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtggtccagaatggaggggtgccaactcgtgtgctcatcctcggttcgacgggttcgatc
ggcgtgcaggcgctcgaggtcatccgcgagcatccggatcggtttcgcgtcgtcggactc
ggtgcgggcggctcgaacgcggccctgctgaccgcccaggcgaccgagttcgggatcggg
cccgaccggatcgcggttgccgatccggtggccgcgcaccaactcgcggacgatctcggc
ggtccggtgatcgcgggccccgacgccatgtgtgagctgatcgacagcgtcgaggccgac
gtgattctcaacgccgtcgtcgggtcgatcggactcgcaccgagcctcgccgcgttgcgg
accggggcccgcctggcgctggcgaacaaggaatctctggtggcgggcgggtcgctggtg
ctcgacgccgccgcgcccggtcagatcgtcccggtggactccgaacactccgccatcgcc
cagtgtctgcgggccggcagtgccgacgaggtcgaccggctggtcctcaccgcgtcgggc
gggcccttccggggctggacccgcgctcagctcgaggacgtgacacctgaacaggcaggc
cggcatccgacgtggtcgatgggcccgatgatcaccctcaactcggcgacgctggtcaac
aaggcactcgaggtcatcgaggcacatctgctgttcggagtggattacgaccacatcgac
gtgacggttcacccgcactcgatcgtgcactcgatggtgaccttcgtcgatggtgcaacc
gtcgccaaggcgtcgccgccgtcgatgaaactgccgatcgcgctcgccctcggctggccc
gaccgggtccccggctcgtcgtcggcgtgcgacttctcgacggccgcgcagtggaccttc
gaaccggtcgacaacgaggtgttcccggcgatcgacctcgcccgagatgccggacgggcc
ggcggcagcatgaccgcggtgttcaacgccgccaacgaggccgctgcggccggcttcttc
gacggcgtcatccgcttcccgcgcatcgtcgagatcgttgccgaggtgctcggcgaggcc
gatcagtggtcgtctgcgccgggtagtgtggaggaggtcttcgcagccgatcaatgggcc
cgtgatcgcgccgcggtcctggtgctggatggagtgagtacgtga

DBGET integrated database retrieval system