KEGG   Gordonia bronchialis: Gbro_2134Help
Entry
Gbro_2134         CDS       T01102                                 

Definition
ATPase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gbro_2134
Enzymes [BR:gbr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Gbro_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2265483..2267507
Genome map
AA seq 674 aa AA seqDB search
MTARSDDRPGDPVTGEARFPFSAVVGQDRLKLALILSAISPGIGGVLIRGEKGTAKSTIV
RGLGPLLAAGNDEHDDGRGRVVELPIGATEDRVIGSLDLTSVLRDGRAEFTPGLLARADG
GVLYIDEVNLLADHLVDVLLDAAASGRVTIEREGVSHTQSAVFVLVGTMNPEEGELRPQL
LDRFGLAVDVAAGKDIDERVEVVARRMAFDADPHAFVAAHADAERELAARIAAARTALPS
VTVPTSELRRIAGICAHLVVDGLRGDIVVARTAAAHAAWRGATSVDESDVRAAVELALPH
RRRRNPFDESGLTDEQLDDAMNAGAEATGPDDPGPDDPNPDDPNPDDRGPDDDGPGGDGL
DGAADGPEPSPNTATDTPEPPDSAAGENDSSSQPQTVPGPRFGPATTPTGRRLRTLRVAG
VGDGEPGRRSRARSRRGQTTHAIDFERGRPVHLFATVLGAVVRGAQTAGPTPALTGTLVT
EDDLRAAQRIGQESNLVVFVVDLSGSMTARRRLAAVSELCVDLLRDSYTRRDRVAVVVAR
GSRASLVVPPTKSVDIAVRCLADVRTGGRTPLAEGLLAAAEVIERSRRSEPDRRPLLVVL
TDGRATAGADAAGRARRAAGHIARRGVDSVVVDCEQGMVRLGMAAQLAAHLSADLVAIDD
LSLSALAHRSRPAA
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcgagaagcgatgaccgccccggtgatccggtgaccggcgaagcgcgtttcccg
ttcagcgcggtcgtcggacaggaccggctcaagctggcgctcatcctgtcggccatctca
ccggggatcggcggcgtgcttatccgcggtgagaagggcaccgcgaagtcgaccatcgtc
cgtgggctcggacccctgctggccgcaggcaatgacgagcacgacgacggacgcggccgg
gtcgtcgagttgcccatcggcgccaccgaggaccgggtgatcggctcattggatctgacc
tcggtgctgcgtgacggccgggccgagttcacccccggtctgctcgcccgggccgacggt
ggggtcctctacatcgacgaggtcaatctgctggccgaccatctcgtcgacgtcctgctc
gacgccgcggccagcgggcgagtgacgatcgagcgagaaggtgtgtcgcacacccaatct
gcggtcttcgtcctcgtcggaaccatgaatccagaagagggtgaactgcgtccgcagctg
ctggaccggttcggtctggcggtggacgtggcggccggcaaggacatcgacgaacgggtc
gaggtggttgcgcggcggatggcgttcgacgccgacccgcacgccttcgtcgcggcccac
gccgacgccgaacgcgaactggcggcccggatcgcggccgcgcgtacggcacttccctcg
gtgacggtgccgacctcggaactgcgccgcatcgccggcatctgtgcccacctcgtcgtc
gacggactccgcggcgacatcgtcgtcgcacggaccgcggccgcgcacgccgcctggcgt
ggggccacgagtgtcgacgagtccgacgtccgcgccgccgtggaactcgcgttgccgcat
cgtcggcggcgcaaccccttcgacgagtccgggctcaccgacgaacagctcgacgacgcc
atgaacgccggtgccgaggccaccggcccggacgaccccggtcccgacgatcccaacccc
gacgatcccaacccggacgaccgcggccccgatgacgacggccccggcggggacggtctc
gatggtgcagccgatggtcccgagccgtcgccgaacaccgcgaccgacacccctgaaccg
ccggattcggctgccggagaaaatgattcgtcatcgcagccgcagaccgtgccgggcccg
aggttcggccccgccaccacccccaccggtcggcgcctgcggaccctgcgagtggcggga
gtcggtgacggcgagccgggacgacggtcgcgggcccgcagtcggcgtgggcagaccacc
cacgcgatcgacttcgaacgcggacgtcccgtccatctgttcgccacggtgctcggcgcc
gtcgtgcgaggcgcacagacggccgggcccacacctgcgttgaccggcacgctcgtcacc
gaggacgacctgcgcgccgcgcaacgcatcggtcaggagtccaatcttgttgtcttcgtt
gtcgatctgagtggatcgatgacagcccgacgacgtctcgccgcggtctccgaactgtgc
gtcgacctgctccgtgactcctacacccgacgtgaccgcgtcgccgtcgtcgtcgcgcgc
ggctcgcgggcatcccttgtggtgccgcccaccaagtcggtcgacatcgccgtccggtgc
cttgccgacgtccggaccggcggccggacgccgctcgccgaggggctgctggcggcagcc
gaggtcatcgagcggtcgcggcgcagcgagcccgaccggcgtccgctgctggtggtgctc
accgacggtcgcgcgaccgccggggcggacgccgccggccgggcgcggcgcgcggcgggc
cacatcgcccggcgcggcgtggacagcgtcgtggtcgattgcgagcaggggatggtgcgt
ctgggaatggcggcgcagctggcggcgcacctgtccgccgatctcgttgccatcgacgac
ctctcgctctcggccctggcccaccgatcccgacccgccgcctga

DBGET integrated database retrieval system