KEGG   Gordonia bronchialis: Gbro_2158Help
Entry
Gbro_2158         CDS       T01102                                 

Definition
tRNA pseudouridine synthase B
Orthology
K03177  
tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
gbr  Gordonia bronchialis
Brite
Enzymes [BR:gbr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Gbro_2158
Transfer RNA biogenesis [BR:gbr03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Gbro_2158
 Prokaryotic Type
    Gbro_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2291718..2292617
Genome map
AA seq 299 aa AA seqDB search
MADSSIENAGLLIVDKQAGITSHDVVSRCRKIFNTRRVGHAGTLDPMATGVLVIGIERAT
KLLGLLSLTTKSYEATIRLGAATTTDDLEGEIIASADASAVTDEQIHSVVAGLTGDIEQV
PAKVSAIKVDGRRAHALVRTGAEFDLAARPVTVRRFDVVDTRRDGHFVDLDVVVDCSAGT
YIRSLARDLGAELGVGGHLTALRRTAVGPFTLEHALTLDEVRERPHVSLDIDEAVKISFP
HRDIDDDEAESISQGRWLDPIGMKGIYMVVDPAQRAIALVQEKGRRASSVMVVRPATLR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggccgattcgtccatcgagaacgccggtctgctcatcgtggacaagcaagccggtatc
acgagccacgacgtcgtctcacgatgccgcaagatcttcaacacccgccgggtcggtcac
gccggcaccctcgacccgatggccaccggcgtcctcgtgatcggaatcgagagggccaca
aaactgttggggctgctgtcgctgaccaccaagtcgtatgaagcgaccattcggctgggt
gcggcgaccaccaccgacgaccttgagggcgagatcatcgcgagcgccgacgcgtcggcg
gtcaccgacgaacagatccattcggtggtcgccggcctgaccggtgacatcgagcaggta
cccgccaaggtgagtgccatcaaggtcgatggtcgccgcgcacacgctctggtgcgcacg
ggtgctgagttcgatcttgccgcccggccggtcaccgtgcggcgattcgacgtcgtcgac
acccgccgcgacgggcacttcgtcgacctcgacgtggtggtggactgttcggctgggacc
tacatccgttcgctcgcacgcgatctcggagccgagctgggtgtgggtgggcacctcacg
gcgttgcgtcgcacagccgtcgggccgttcaccctcgagcacgccctgaccctcgacgag
gtccgggaacgcccgcacgtgagcctcgacatcgacgaggcggtgaagatctccttcccg
caccgcgacatcgacgacgacgaggccgagtcgatcagtcagggacgctggctcgacccg
atcgggatgaaggggatctacatggtcgtcgaccccgctcagcgggccattgcgctggta
caggagaagggccgccgggcgagttcggtgatggtggtacgcccggcgaccctgcggtga

DBGET integrated database retrieval system