KEGG   Gordonia bronchialis: Gbro_2177Help
Entry
Gbro_2177         CDS       T01102                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gbr  Gordonia bronchialis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gbr00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:gbr00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2309377..2309883
Genome map
AA seq 168 aa AA seqDB search
MPRSIVLVWAQDRAGAIGRANTIPWHVPEDMARFRQITGTDPVVMGRRTWESLPDRFRPL
PRRRNIVVTRSVGFVADGAEVVHSVDAAVALPDERLVVIGGGEIYSAVMESATHLKVTEL
DLLVPEADAFAPEVDEYVWEVENAGDWEMSSGGVRYRFVDYRRHRAAP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcagcatcgtgctcgtctgggcccaggaccgtgcgggcgcaatcggacgggcc
aacaccattccgtggcacgtccctgaagacatggcccggttccgccagatcaccggcacc
gatccggtggtcatgggtcgacgaacgtgggagtccctgcccgatcgcttccggccgcta
ccgcgacgacgcaacatcgtcgtcacccgttcggtgggcttcgtcgccgacggcgccgag
gtggtgcactccgtcgatgcggccgtggccctccccgatgagcgtctggtcgtcatcggt
ggcggcgagatctattcggctgtcatggaatcggcgacccacctgaaagtgaccgagctc
gatctgctggtgcccgaggcggatgcctttgcacccgaggtcgacgaatatgtgtgggaa
gtggagaacgccggcgactgggagatgtccagtggcggagtccgttaccggtttgtcgac
taccgcaggcaccgggctgcgccatga

DBGET integrated database retrieval system