KEGG   Gordonia bronchialis: Gbro_2264Help
Entry
Gbro_2264         CDS       T01102                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gbr  Gordonia bronchialis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gbr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2404728..2406155
Genome map
AA seq 475 aa AA seqDB search
MSRPVMSRRIRVAVVGGGISGLTAAFRLRQALGSDAQIDVVESSDRLGGVLRTVDVGGRA
VDVGAEAFIVRRPEALALIDELGLADDVVSPSGARPAIWSGAGLHPLPAPALMGIPASPE
PVAGLVDSDDLDRLAGEADRPLNWSVTQNPTVGDLVADRFGPSVVARSVDPMLGGVYSSL
AADIGLREAIPALAARLDGGSPSLTAAVRSVIDSGAGASGPVFGTLIGGYRRLLDALTAA
AAVTPALARAVVTLGSGADGWTLGFGDGGSADYDGVVLAVPAPVAGELLTESAPAIGEAL
VAVPRASSVVVSIALEPGTRLPDHSGVLVATGETLRAKAFTFSSRKWPHLAGDDEPVSVR
ASFGRHGAPVPDEDDEPGVGERLVADALADLDAVCAAAGVNAVSARVVDSYVQRWPGGLP
VYGPGHLAAMARVDAHRPPRLALAGSAYAGVGVPACIGRAGRAAAAVVADLTPET
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggccggtgatgtcgcggcggattcgggttgcggtggtcggcggcgggatctcg
ggactgaccgccgcgttccgtcttcgccaggcgctcggatccgacgcacagatcgacgtc
gtcgaatcgagtgaccggctcggtggcgtcctgcgcaccgtcgacgtgggcgggcgggcg
gtggacgtgggcgctgaggcgttcatcgtgcgacgtcccgaggcgctcgcgttgatcgac
gagctgggcctggccgatgacgtggtgtcgccgtcgggagcccgcccggcgatctggtcc
ggcgcgggactgcacccactgcccgcgcccgccttgatgggtattcccgcgtcacccgaa
cccgttgccggacttgtcgattccgacgatctcgacaggctggccggtgaagctgaccgc
ccgctgaactggtcggtgacgcagaatccgacggtcggggacctggtggccgaccggttc
ggtccatcggtggtggcacgcagtgtggacccgatgctgggcggtgtctactccagcctg
gccgccgacatcgggctgcgagaggcgatccccgccctcgccgcgcgactcgacggcggc
tcgccgtcactgaccgcggcggtgcggtcggtcatcgactccggtgccggtgcgtcgggt
ccggtgttcggcacgctgatcggcggctatcggagactgctcgacgcgctgacggcggcg
gcagcggtgacccccgcgttggcccgcgcggtcgtcaccctgggttccggcgccgacggg
tggacactcgggttcggtgacggcggatcggccgactacgacggcgtcgtgctggcggtt
ccggcaccggtcgccggagaactgctcaccgaatccgcgccggcgatcggcgaggcactc
gtcgcggtgccgcgcgcgtcgtcggtggtggtgtcaatcgccctggaacccggcacgcgc
ctgcccgatcactctggagttctcgtggccaccggagaaaccctgcgcgccaaggcattc
accttcagctctcgtaagtggccgcatctcgcgggcgacgacgagccggtgtcggtgcgg
gcatcgttcggccgccatggcgcaccggtccccgacgaggacgacgaacccggcgtcggg
gaacggctggtggccgacgcgctcgccgacctcgacgcggtgtgtgcggcggccggggtg
aacgcggtgtcggcacgggtcgtcgactcgtatgtccagcgctggcccggtggcctgccc
gtctacgggccgggtcacctcgcggcgatggccagggtcgatgcgcaccggccgccccgt
ctggccctggccggctcggcctacgccggtgtcggcgtgcccgcctgcatcgggcgggcc
ggtcgggcggcggcggcggtggtcgccgatctcacacccgagacctga

DBGET integrated database retrieval system