KEGG   Gordonia bronchialis: Gbro_2301Help
Entry
Gbro_2301         CDS       T01102                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gbr  Gordonia bronchialis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gbro_2301
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Gbro_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2440418..2441011
Genome map
AA seq 197 aa AA seqDB search
MIASVRGPVLEVALDHAVIDCGGVGYRVLATPVTLSRLRRGEESTLLTSMIVREDSMTLY
GFTEPDARALFALLQTVTGVGPRLAMATLAVLEPEALRRALAESDTKALTSVPGIGKRVA
ERLVVELRDKVDRPTGESAVGVVAPGGVREQVADALVGLGFTAGPAEKAVAAVLADHPDA
DASTALRQSLSLLGKAS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttcggtgcgtggacccgtactggaggtcgcgctcgatcacgccgtgatcgat
tgcggcggagtgggttaccgggttctggcgaccccggtgacgctgtcgcggttgcggcgc
ggtgaagaatccacactgctgacgtcgatgatcgtgcgggaggactcgatgaccctctac
gggttcaccgagcccgacgcgcgagcgttgttcgcgttgctgcagaccgtcaccggtgtc
gggccgcggctggcgatggccaccctcgcggtcctcgaaccagaggcgttgcgacgcgcg
ctggccgagtccgacaccaaggcgctgacgtcggtgcccggcatcggaaaacgcgtcgcc
gaacgcctggtggtggaactgcgcgacaaagtggatcgcccgaccggtgaatcggccgtc
ggggtcgtcgccccgggcggcgtccgcgaacaggtcgccgacgccctggtcggtctcgga
ttcacggccggtccggccgagaaggccgtggccgccgttctcgccgaccatcccgacgcc
gacgcgtcgacggcgctacgacagtcgctgtcgctgttgggaaaggcgtcgtag

DBGET integrated database retrieval system