KEGG   Gordonia bronchialis: Gbro_2336Help
Entry
Gbro_2336         CDS       T01102                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gbr  Gordonia bronchialis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Gbro_2336
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_2336
Enzymes [BR:gbr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Gbro_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2484230..2485180
Genome map
AA seq 316 aa AA seqDB search
MMRRLLSTADLSRDEATELLDEAQRFEQALMGREVRKLPTLRGRTVMTVFYENSTRTRVS
FEVAGKWMSADVINVSASSSSVGKGESLRDTAKTLQAAGADALIVRHPASGAPAQIADWT
TAADGTGPAVINAGDGTHEHPTQALLDALTLRQRLGSLDGRRIAIVGDVVHSRVARSNAH
LLATLGAEVVLVAPPTLLPVGVEQWPVAVSGNLDAELAGVDAVMMLRVQAERMNGGFFPS
AREYSLRFGLNERRLGLLADDAVVLHPGPMLRGMEIGYSVADSPRAAVLDQVRNGVHVRM
AVLFRLLVGTDSAGAQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacgcctgctctccaccgccgatctgagccgcgacgaggccaccgaactgctc
gacgaggcgcaacggttcgaacaggcactgatgggccgcgaggtccgcaaactgcccacc
ctgcgcggccgcaccgtgatgactgtcttctacgagaactccacccgcacccgggtgtcc
ttcgaggtcgccggtaagtggatgagcgccgacgtcatcaacgtcagcgcgtcgagttcg
tctgtgggcaaaggggaatcgctgcgcgacaccgccaagaccctccaggcggccggcgca
gatgcgctcatcgtgcgccatcccgcctcgggtgcacccgcccagatcgccgactggacg
accgccgccgacggcaccggtcccgcggtgatcaacgccggcgacggcacccacgaacat
cccacccaggcgctgctcgatgcgctcacgttgcggcagcgactcggatcgctcgacggt
cgtcgcatcgcgatcgtgggtgacgtggtgcactcccgggtcgcccggtccaacgcgcat
ctgctggccaccctcggcgccgaggtggtgctggtggctccgccgacactgctgccggtg
ggcgtcgaacagtggccggtcgcggtctccggcaacctcgacgccgaactggccggcgtc
gacgcggtgatgatgctgcgcgtgcaggccgagcggatgaatgggggattcttcccgagc
gcacgtgagtactcgctgcgcttcggactcaacgaacgccgcctcggcctgctcgccgac
gacgccgtggtgctgcatcccggaccgatgttgcgcggcatggagatcggctactccgtc
gccgactcaccgcgcgcggccgtgctcgaccaggtgcgcaacggcgtccatgtccgcatg
gcggtgctcttccgactgctcgtcggaaccgattcggcaggagcgcaatag

DBGET integrated database retrieval system