KEGG   Gordonia bronchialis: Gbro_2336Help
Entry
Gbro_2336         CDS       T01102                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
gbr  Gordonia bronchialis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gbr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gbr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2484230..2485180
Genome map
AA seq 316 aa AA seqDB search
MMRRLLSTADLSRDEATELLDEAQRFEQALMGREVRKLPTLRGRTVMTVFYENSTRTRVS
FEVAGKWMSADVINVSASSSSVGKGESLRDTAKTLQAAGADALIVRHPASGAPAQIADWT
TAADGTGPAVINAGDGTHEHPTQALLDALTLRQRLGSLDGRRIAIVGDVVHSRVARSNAH
LLATLGAEVVLVAPPTLLPVGVEQWPVAVSGNLDAELAGVDAVMMLRVQAERMNGGFFPS
AREYSLRFGLNERRLGLLADDAVVLHPGPMLRGMEIGYSVADSPRAAVLDQVRNGVHVRM
AVLFRLLVGTDSAGAQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgacgcctgctctccaccgccgatctgagccgcgacgaggccaccgaactgctc
gacgaggcgcaacggttcgaacaggcactgatgggccgcgaggtccgcaaactgcccacc
ctgcgcggccgcaccgtgatgactgtcttctacgagaactccacccgcacccgggtgtcc
ttcgaggtcgccggtaagtggatgagcgccgacgtcatcaacgtcagcgcgtcgagttcg
tctgtgggcaaaggggaatcgctgcgcgacaccgccaagaccctccaggcggccggcgca
gatgcgctcatcgtgcgccatcccgcctcgggtgcacccgcccagatcgccgactggacg
accgccgccgacggcaccggtcccgcggtgatcaacgccggcgacggcacccacgaacat
cccacccaggcgctgctcgatgcgctcacgttgcggcagcgactcggatcgctcgacggt
cgtcgcatcgcgatcgtgggtgacgtggtgcactcccgggtcgcccggtccaacgcgcat
ctgctggccaccctcggcgccgaggtggtgctggtggctccgccgacactgctgccggtg
ggcgtcgaacagtggccggtcgcggtctccggcaacctcgacgccgaactggccggcgtc
gacgcggtgatgatgctgcgcgtgcaggccgagcggatgaatgggggattcttcccgagc
gcacgtgagtactcgctgcgcttcggactcaacgaacgccgcctcggcctgctcgccgac
gacgccgtggtgctgcatcccggaccgatgttgcgcggcatggagatcggctactccgtc
gccgactcaccgcgcgcggccgtgctcgaccaggtgcgcaacggcgtccatgtccgcatg
gcggtgctcttccgactgctcgtcggaaccgattcggcaggagcgcaatag

DBGET integrated database retrieval system