KEGG   Gordonia bronchialis: Gbro_2345Help
Entry
Gbro_2345         CDS       T01102                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
gbr  Gordonia bronchialis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gbr00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2495084..2495665
Genome map
AA seq 193 aa AA seqDB search
MVGPSAVGKSTVVARVRDRLPQLYFSVSATTRAPRPGEVDGRDYHFVDAAEFDRMIADDE
LLEWAEIHGGLQRSGTPARPVLDALAAGVPVLVEVDLVGARNVVARLPEAITVFLAPPSW
DELVNRLTGRGTESPEAVERRLATARTEMAAQNEFHHVVVNSEVDQAADELVSLLVGPSQ
PASPTRQDAAGTR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttggtcggcccctcggccgtcggtaaatccaccgtggtggcccgggtacgagaccgcttg
ccgcagttgtacttcagtgtctcggccaccacccgcgcaccgcggcccggcgaggtcgac
ggccgcgactaccacttcgtcgacgccgccgaattcgaccggatgatcgccgacgacgag
cttctcgaatgggccgagatccatggcggactgcagcggtcggggacacccgcccgcccg
gtcctcgacgccctcgccgccggtgtgcctgtcctcgtcgaggtcgatctggtgggggcg
cgcaacgtcgtcgcccggctaccggaggcgatcacggtgttcctggccccgccgagctgg
gacgagctcgtcaaccgtctcaccggtcgcggtaccgagagtcccgaggcagtggagcgg
cgactggcaaccgcgcggaccgagatggccgcgcagaacgagttccaccacgtcgtcgtg
aacagcgaagtcgaccaggcggccgatgagttggtatccttgctggtcggaccttctcag
cccgcctcgcccacccggcaggatgccgcgggcacccgctga

DBGET integrated database retrieval system