KEGG   Gordonia bronchialis: Gbro_2365Help
Entry
Gbro_2365         CDS       T01102                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00010  Glycolysis / Gluconeogenesis
gbr00051  Fructose and mannose metabolism
gbr00562  Inositol phosphate metabolism
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01200  Carbon metabolism
gbr01230  Biosynthesis of amino acids
Module
gbr_M00002  Glycolysis, core module involving three-carbon compounds
gbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_2365
   00051 Fructose and mannose metabolism
    Gbro_2365
   00562 Inositol phosphate metabolism
    Gbro_2365
Enzymes [BR:gbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gbro_2365
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gbro_2365
  Exosomal proteins of bladder cancer cells
   Gbro_2365
  Exosomal proteins of melanoma cells
   Gbro_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY21607
UniProt: D0LCT6
Position
2516498..2517286
Genome map
AA seq 262 aa AA seqDB search
MADRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVIPPFTDIRSVQTVVDG
DKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTMHAETDEVVLAKTK
AALRHGLTPIVCIGEGLDIRESGEHVAYNVAQLKGSLAGLSAEEIGKVVIAYEPVWAIGT
GRVASADDAQEVCKAVRQTLAEIADDATASSVRVLYGGSVNAKNVGDIVGQTDVDGALVG
GASLKSDEFATLSAIAAGGPLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgtaagcccctgatcgccggcaactggaagatgaacctgaatcatctcgag
gcgatcgcgctggtgcagaagatcgccttcgccctgccggcgaagtacttcgacaaggtc
gacgtcacggtgatcccgccgttcaccgacatccgaagcgtgcagaccgtcgtcgacggt
gacaagttgttgctcacctacggtgcgcaggatctgtccgcacacgattcgggtgcctac
accggtgagatcagcggtgcgttcctggccaagctggggtgcaccttcgtggtggtcggc
cactcggagcggcgcaccatgcacgccgagaccgacgaggtggtgctcgccaagaccaag
gcggcgctcaggcatggcctgaccccgatcgtctgtatcggcgagggcctcgacatccgc
gagtccggcgaacacgtcgcctacaacgtcgcccagctcaaaggctcgctggccggcctg
tcggccgaggaaatcggcaaggtcgtcatcgcctacgaaccggtctgggcgatcggcacc
ggccgcgtggccagcgccgacgacgcgcaggaggtgtgcaaggcggttcggcagacgctc
gccgagatcgccgacgacgccaccgcgtcctcggttcgtgtgctctacggcgggtcggtc
aatgccaagaacgtcggcgacatcgtcggacagaccgacgtggacggcgcactggtcggc
ggggcatcgctgaagtcggacgagttcgcgacactgtcggcgatcgcggccggcggcccc
ctaccctga

DBGET integrated database retrieval system