KEGG   Gordonia bronchialis: Gbro_2365Help
Entry
Gbro_2365         CDS       T01102                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbro_2365
   01230 Biosynthesis of amino acids
    Gbro_2365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_2365
   00051 Fructose and mannose metabolism
    Gbro_2365
   00562 Inositol phosphate metabolism
    Gbro_2365
Enzymes [BR:gbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Gbro_2365
Exosome [BR:gbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Gbro_2365
  Exosomal proteins of bladder cancer cells
   Gbro_2365
  Exosomal proteins of melanoma cells
   Gbro_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2516498..2517286
Genome map
AA seq 262 aa AA seqDB search
MADRKPLIAGNWKMNLNHLEAIALVQKIAFALPAKYFDKVDVTVIPPFTDIRSVQTVVDG
DKLLLTYGAQDLSAHDSGAYTGEISGAFLAKLGCTFVVVGHSERRTMHAETDEVVLAKTK
AALRHGLTPIVCIGEGLDIRESGEHVAYNVAQLKGSLAGLSAEEIGKVVIAYEPVWAIGT
GRVASADDAQEVCKAVRQTLAEIADDATASSVRVLYGGSVNAKNVGDIVGQTDVDGALVG
GASLKSDEFATLSAIAAGGPLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccgtaagcccctgatcgccggcaactggaagatgaacctgaatcatctcgag
gcgatcgcgctggtgcagaagatcgccttcgccctgccggcgaagtacttcgacaaggtc
gacgtcacggtgatcccgccgttcaccgacatccgaagcgtgcagaccgtcgtcgacggt
gacaagttgttgctcacctacggtgcgcaggatctgtccgcacacgattcgggtgcctac
accggtgagatcagcggtgcgttcctggccaagctggggtgcaccttcgtggtggtcggc
cactcggagcggcgcaccatgcacgccgagaccgacgaggtggtgctcgccaagaccaag
gcggcgctcaggcatggcctgaccccgatcgtctgtatcggcgagggcctcgacatccgc
gagtccggcgaacacgtcgcctacaacgtcgcccagctcaaaggctcgctggccggcctg
tcggccgaggaaatcggcaaggtcgtcatcgcctacgaaccggtctgggcgatcggcacc
ggccgcgtggccagcgccgacgacgcgcaggaggtgtgcaaggcggttcggcagacgctc
gccgagatcgccgacgacgccaccgcgtcctcggttcgtgtgctctacggcgggtcggtc
aatgccaagaacgtcggcgacatcgtcggacagaccgacgtggacggcgcactggtcggc
ggggcatcgctgaagtcggacgagttcgcgacactgtcggcgatcgcggccggcggcccc
ctaccctga

DBGET integrated database retrieval system