KEGG   Gordonia bronchialis: Gbro_2398Help
Entry
Gbro_2398         CDS       T01102                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00984  Steroid degradation
gbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Gbro_2398
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Gbro_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 DAO GIDA FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ACY21640
UniProt: D0LDL7
Position
complement(2556110..2557726)
Genome map
AA seq 538 aa AA seqDB search
MKRDISTQGVSRRSVLVGAAGLGALGALDAAVAPRAHATPAPGPSAIVIGSGFGGAVAAL
RLGRAGISTTVLERGRRWPIRPDGNTFATFTSPDRRAAWFSDTVGLTGTIGIPVTRYPGI
LDRIKGNGIDAVYGAGVGGGSLAFGAFTPVPRRVDFEHVFPGGADYDELVRTYYPRAKKM
LGASPLPADIMAHPRYVGTRSWRATVRRYGKEPVSFDYAINWDVVRDELAGRIKPAIITG
ELGFGVNSGAKNSVDHNYLPAAEATGHVTIKPMHEVFEIRPRERRRGFVVSARVIDENHR
TVQVVTLEADYLFLAAGSFHTTRMLVEARAKGTLPRLSPRIGDGFGANGDFLTARTALSD
DYGAVQGGPGFGRVYEDDMPGGPVSMVYHSTPVPAPLGKTLTTNLIQAHTEERGTIDYDH
ATRSAVINYPHPEGNDLDRRGAAFAERFRQRAEIRHGRTTSGVPVYSRAAGFGSASTYHG
LGGVVMNRAATMDGAVRGYENLYVVDGSFVPGAVGLVNPALTITALAERTMERFLARR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgagacatttccacccaaggcgtctctcgccgttccgttctggtcggcgccgcc
ggcctcggtgccctcggcgcgctggacgccgccgtcgcaccccgggcgcacgccacgccg
gcaccgggtcccagcgcgatcgtcatcggcagcgggttcggcggtgcggtcgcggcgctg
cgtctcggccgggccgggatctccaccaccgttctcgaacgcggtcggcgctggccgatc
cgcccggacggcaacacctttgccacgttcacctccccggaccggcgcgcggcctggttc
agcgacacggtcggactgaccggcacgatcggcatcccggtcacgcggtacccgggcatc
ctcgaccgcatcaagggaaacggcatcgacgcggtgtacggcgccggagtcggtggcggt
tcgctggccttcggcgccttcacacccgtaccccgccgcgtcgacttcgagcacgtcttc
cccgggggcgccgactacgacgaactggtacgcacgtactacccgcgcgcaaagaagatg
ctcggcgcgtcgcccctgccggccgacatcatggcgcatccgcgttacgtgggcacccgc
tcctggcgggccaccgtccgccgttacggcaaagagcctgtcagcttcgactacgccatc
aactgggacgtggtccgcgacgagctggccgggcgcatcaagcccgccatcatcaccggt
gaactcggcttcggcgtcaacagcggtgccaagaactccgtggaccacaactacctgccg
gccgccgaggccaccggccacgtcacgatcaaacccatgcacgaggtcttcgagatccgt
ccgcgagaacgtcgccgaggattcgtcgtgtccgcgcgcgtcatcgacgagaaccaccgc
acagtccaagtggtgaccctcgaagccgactatctgttcctcgcggccggctccttccac
accacccggatgctggtggaggcgagggcaaagggcaccttgccccggctctcaccccgc
atcggcgacggcttcggcgccaacggtgacttcctcaccgcccggaccgcactctccgac
gactacggtgccgtgcagggcgggcccgggttcggccgggtctacgaggacgatatgccc
ggcggaccggtatcgatggtctatcactccacaccggtgcccgcaccactcggaaagacg
ttgaccaccaacctcatccaggcgcataccgaggagcgaggcaccattgactacgatcac
gcgacccgttcggcagtcatcaactacccccacccggagggcaacgatctcgaccgccgc
ggcgcggcgttcgccgagcggttccggcagcgcgcggagatccggcacggacgtaccacg
agcggcgtgcccgtctattcgcgggcggccggcttcgggtcggcgagcacgtatcacggc
ctgggtggggtggtgatgaaccgcgcggcgacgatggacggcgcggtgcgcggctacgag
aacctgtacgtcgtcgacggctcgttcgtgccgggcgcggtgggactggtgaacccggcg
ctgaccatcaccgcactcgccgaacggacgatggaacggttcctggcgcggcgttga

DBGET integrated database retrieval system