KEGG   Gordonia bronchialis: Gbro_2399Help
Entry
Gbro_2399         CDS       T01102                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00984  Steroid degradation
gbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Gbro_2399
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Gbro_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C NAD_binding_8 Pyr_redox_2 FAD_binding_2 GMC_oxred_N FAD_binding_3 GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ACY21641
UniProt: D0LDL8
Position
complement(2557805..2559346)
Genome map
AA seq 513 aa AA seqDB search
MSTATGRATDPAQAGNTPTAIVIGSGFGGAVAALRLGQAGFRTTVFERGRRWPIRRDQNT
FATFDRPDRRAAWFRDSAGISSALQVPVERYPGVLDTISGNGVETVYGAGVGGGSLVFGA
FSAQPDRPDFELVFPGGTGYSELDRIYYPRARRMLGASNVPADVLAHPNYVGARSWLRVI
ARYGVTPRFIDYAVDWDIVREELAGRARPGVSIGDLSYGVNSGAKNSVDHNYLPAAEATG
NVTIKPMHEVFEIRTRSRRAGFVVRARQIDDRHRTVRVVSAEADHLFMAAGSFHTTSLLV
QARARGLLPNLSARIGDGFGTNGDFLIVRTALRDPYGPLQGGPGYARIREDRLPGGPVAI
VYQASPFPSPLGGVATTHLIQVHTDERGTIDFDHATGGTRLTYPHRAGSSTLDRRAIAFA
RHFHERTETRHGYPLNGIPLFDRAYGFGSASTFHGLGGVVVGRAATPDGAIIGYDNLHVV
DGSFCPGAVGLVNPSLTITALAERIMDRFLTRH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacggccaccggccgagccacggaccccgcgcaggccgggaacacgccgacggcc
atcgtcatcggtagcgggttcggcggtgcggtggcagcactccgtctgggacaggccggt
tttcgcacgacggttttcgaacgcggccgccgatggccgatccgtcgcgaccagaacacg
tttgccacctttgaccggcccgaccgccgggccgcgtggtttcgggacagcgcagggatc
tccagcgccctgcaggtgcccgtggagcgctatcccggtgtgctggacacgatctccgga
aacggcgtcgaaacggtgtacggggcgggcgtcggcggcggctcgctggtgttcggcgcg
ttctcggcacaacccgaccgacccgacttcgaactcgtattcccaggcggcacaggctat
tccgaactcgaccggatctactacccgcgtgcacggcgcatgctgggcgcgagcaacgtg
ccagcggatgttttggcccaccccaactacgtgggcgcacggtcgtggctgagggtcatc
gcgcggtacggcgtcacaccgcgattcatcgattacgccgtcgactgggacatcgtccgc
gaggagttggccggccgggcccgccccggcgtgagcatcggcgatctctcctacggtgtg
aacagcggggccaagaactccgtggaccacaattacctgccggccgccgaggccaccggc
aacgtcaccatcaaacccatgcacgaggtcttcgagattcgaacacgttctcgccgagcg
ggtttcgtcgtccgggcccggcagatcgatgaccggcaccgcaccgttcgggtggtcagc
gccgaggccgatcacctgttcatggccgctggctccttccacacgacatcgctgctcgtg
caggccagggcacgcggactgttgccgaatctgtcagccaggatcggtgacggtttcggc
accaacggtgacttcctcatcgtgcgtaccgccctgcgcgatccctacggccccctgcag
ggaggtccgggatatgcgcggatccgggaggaccgtcttcccggcggtccggtggcgatc
gtctaccaggccagtcccttcccgtcgccactcggcggcgtggccaccacccatctcatt
caggtacacaccgacgagcgcggcaccatcgatttcgaccacgccaccggtggcacccgg
ctcacctatccacatcgcgccggcagtagcacactcgaccggcgcgcgatcgccttcgcc
cggcacttccacgagcgaaccgagacacgacatggatacccgctcaacgggattccgctg
ttcgaccgcgcctatgggttcggttcggcgagcaccttccacggtctcggcggagtggtc
gtgggtagggcggcgacgccggacggcgcgatcatcggctacgacaatctccacgtcgtc
gacggctcattctgcccgggcgcggtcggcctggtgaacccgtcgctcaccatcaccgcg
ctcgccgaacgcatcatggatcgcttcctgacacgtcactga

DBGET integrated database retrieval system