KEGG   Gordonia bronchialis: Gbro_2399Help
Entry
Gbro_2399         CDS       T01102                                 

Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gbr  Gordonia bronchialis
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:gbr00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2557805..2559346)
Genome map
AA seq 513 aa AA seqDB search
MSTATGRATDPAQAGNTPTAIVIGSGFGGAVAALRLGQAGFRTTVFERGRRWPIRRDQNT
FATFDRPDRRAAWFRDSAGISSALQVPVERYPGVLDTISGNGVETVYGAGVGGGSLVFGA
FSAQPDRPDFELVFPGGTGYSELDRIYYPRARRMLGASNVPADVLAHPNYVGARSWLRVI
ARYGVTPRFIDYAVDWDIVREELAGRARPGVSIGDLSYGVNSGAKNSVDHNYLPAAEATG
NVTIKPMHEVFEIRTRSRRAGFVVRARQIDDRHRTVRVVSAEADHLFMAAGSFHTTSLLV
QARARGLLPNLSARIGDGFGTNGDFLIVRTALRDPYGPLQGGPGYARIREDRLPGGPVAI
VYQASPFPSPLGGVATTHLIQVHTDERGTIDFDHATGGTRLTYPHRAGSSTLDRRAIAFA
RHFHERTETRHGYPLNGIPLFDRAYGFGSASTFHGLGGVVVGRAATPDGAIIGYDNLHVV
DGSFCPGAVGLVNPSLTITALAERIMDRFLTRH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacggccaccggccgagccacggaccccgcgcaggccgggaacacgccgacggcc
atcgtcatcggtagcgggttcggcggtgcggtggcagcactccgtctgggacaggccggt
tttcgcacgacggttttcgaacgcggccgccgatggccgatccgtcgcgaccagaacacg
tttgccacctttgaccggcccgaccgccgggccgcgtggtttcgggacagcgcagggatc
tccagcgccctgcaggtgcccgtggagcgctatcccggtgtgctggacacgatctccgga
aacggcgtcgaaacggtgtacggggcgggcgtcggcggcggctcgctggtgttcggcgcg
ttctcggcacaacccgaccgacccgacttcgaactcgtattcccaggcggcacaggctat
tccgaactcgaccggatctactacccgcgtgcacggcgcatgctgggcgcgagcaacgtg
ccagcggatgttttggcccaccccaactacgtgggcgcacggtcgtggctgagggtcatc
gcgcggtacggcgtcacaccgcgattcatcgattacgccgtcgactgggacatcgtccgc
gaggagttggccggccgggcccgccccggcgtgagcatcggcgatctctcctacggtgtg
aacagcggggccaagaactccgtggaccacaattacctgccggccgccgaggccaccggc
aacgtcaccatcaaacccatgcacgaggtcttcgagattcgaacacgttctcgccgagcg
ggtttcgtcgtccgggcccggcagatcgatgaccggcaccgcaccgttcgggtggtcagc
gccgaggccgatcacctgttcatggccgctggctccttccacacgacatcgctgctcgtg
caggccagggcacgcggactgttgccgaatctgtcagccaggatcggtgacggtttcggc
accaacggtgacttcctcatcgtgcgtaccgccctgcgcgatccctacggccccctgcag
ggaggtccgggatatgcgcggatccgggaggaccgtcttcccggcggtccggtggcgatc
gtctaccaggccagtcccttcccgtcgccactcggcggcgtggccaccacccatctcatt
caggtacacaccgacgagcgcggcaccatcgatttcgaccacgccaccggtggcacccgg
ctcacctatccacatcgcgccggcagtagcacactcgaccggcgcgcgatcgccttcgcc
cggcacttccacgagcgaaccgagacacgacatggatacccgctcaacgggattccgctg
ttcgaccgcgcctatgggttcggttcggcgagcaccttccacggtctcggcggagtggtc
gtgggtagggcggcgacgccggacggcgcgatcatcggctacgacaatctccacgtcgtc
gacggctcattctgcccgggcgcggtcggcctggtgaacccgtcgctcaccatcaccgcg
ctcgccgaacgcatcatggatcgcttcctgacacgtcactga

DBGET integrated database retrieval system