KEGG   Gordonia bronchialis: Gbro_2745Help
Entry
Gbro_2745         CDS       T01102                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gbr  Gordonia bronchialis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Gbro_2745
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Gbro_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2923303..2925228)
Genome map
AA seq 641 aa AA seqDB search
MTTPGPGVDLTAAEPYRVLGGAGILARWNAAGVLAAADVHVTDRLTRMCGEPLSDLALLG
TALAVRAVRLGSTCLALDRIGDIPGLPDQPDLVLPAPAELLSELRRCPLVVGTGAGPLRP
LMLMGSDDGPLLYLQKYFRQEETIRTVLAARAATSPQVDPDRLRSAIDTVFGDVTSSETV
DLQRLAAAVVASRWTTVLAGGPGTGKTYTVARILAVLQIVHGGSLRVGLCAPTGRAAAQL
QASVSPGGSAGLDPTLITGAGALHAVTVHSLLGWYPGSNPRFGRGHTLPHDVIVVDETSM
LSMTAMSRVLDAARPDARVIFVGDPHQLASVDAGAVLADLVERTDTDPGPAAGESAHASI
ALQAAGIGPERVSAEAIGPGEAARISRGVITLRREYRFGGGIAAVAAAVNAGDATRVIDL
LTDPDVSDIELIAPDNIDATRPDVTAWGRELRTAALACDAHAAVEALDSHRVLCAHREGY
WGVRGWSRRVAEWLGHDADRPGWFAGQPILVTANDRQTRTFNGDTGVIIRDPHSGDPDDL
RVAFRRGGEVRLLRRTQLAEISTVYAMTIHRSQGSQFDRVTVVLPPSGSELLTRELLYTA
ITRARTAVRVVAAPDVVRAAVERRVQRASGLRSPVTPLAPR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaccggggcctggggtcgatctcactgctgccgaaccgtatcgagtgctgggc
ggggccgggattctggcgcggtggaacgcagccggggtgctcgcggccgccgacgtgcac
gtcaccgaccgcctcaccaggatgtgtggagaaccgctgtctgacctggcgctgttgggc
accgctctggcggtgcgcgcggtacgtctgggctccacctgcctggccctggaccggatc
ggcgacatccccggcctgcccgatcagccggacctcgtgctgccggcgccggccgagttg
ctgagcgaactccgcaggtgtccgctggtcgtcgggaccggtgccggcccgctgcggcca
ttgatgctgatgggctccgacgacggtccattgctatacctgcagaagtactttcggcag
gaggagaccatccggacagtgctggcggctcgggccgccacgtcaccgcaggtcgacccg
gatcggttgcggtcggccatcgacaccgtgttcggagacgtaacatcctcggagactgtc
gatctccagcggctcgccgcagcggtggtggctagtcggtggaccactgtcctcgccggt
ggtcccggcaccggtaagacctacaccgtcgcgcggattctcgccgttctgcagatcgtg
cacggtggcagcctccgcgtcggcctgtgcgcgcccaccggtcgggccgccgcacagctg
caggcctccgtgtcgccggggggttccgccgggctcgatccgacgctgatcacgggtgcc
ggcgcactacacgcggtgactgttcactcgttgctcgggtggtatcccgggtccaatccg
cgtttcggccgcggacacaccctgccgcatgacgtcatcgtcgtcgacgagacctcgatg
ttgtcgatgaccgcgatgagccgggtcctcgacgcggcacggccggatgcgcgggtgatc
ttcgtcggcgacccgcatcagctcgcctcggtggatgccggcgcggtactcgccgatctc
gtggaacgcaccgacaccgatccggggccggccgcaggggagtccgcgcatgcctcgatc
gcgctgcaggcggccggtatcggaccggaacgggtcagcgccgaggccatcgggcccggc
gaggcggcccgtatctcgcgcggcgtgatcaccctgcgtcgcgagtaccggttcggcggc
gggatcgccgcggtggccgcggcggtgaacgccggcgacgcgacccgggtcatcgacctg
ctcaccgatcccgacgtgagcgacatcgagctcatcgcccccgacaacatcgacgcgacc
cgtcccgacgtcaccgcctggggacgcgagttgcgcacggccgcactggcctgcgacgca
cacgccgccgtcgaggcgctcgactcgcatcgcgtgctgtgcgcccaccgcgagggatac
tggggggtccgagggtggtcgcggcgggtcgccgagtggctcgggcacgacgccgatcgt
ccgggatggttcgccggacagccaatcctggtgaccgccaacgaccgtcagaccagaacc
ttcaacggcgacaccggcgtgatcatccgcgacccgcacagcggtgatccggacgacctg
cgggtcgcgttccggcggggcggcgaggtacggctgcttcgccgcactcaactcgccgag
atcagcacggtgtacgcgatgaccatccatcgcagtcagggcagtcagttcgaccgggtc
accgtcgtcctgccaccatccggttccgagttgctgacccgggagctgctctacaccgcg
atcacccgcgcccgcaccgccgttcgggtcgtcgccgccccggacgtggtccgcgccgcg
gtcgaacgccgggtccagcgggccagtggcctgcgctcgccggtgacccccctcgccccc
cgctga

DBGET integrated database retrieval system