KEGG   Gordonia bronchialis: Gbro_2767Help
Entry
Gbro_2767         CDS       T01102                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
gbr  Gordonia bronchialis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbro_2767
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Gbro_2767
   00630 Glyoxylate and dicarboxylate metabolism
    Gbro_2767
Enzymes [BR:gbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Gbro_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2951134..2953308
Genome map
AA seq 724 aa AA seqDB search
MSDRITVDGLQVSSVLYDFINNEALPGTGVDKDAFWSGAAAVIADLAPRNRDLLAVRDDL
QAKIDQWHRDHRGELDFDAYKAFLTEIGYLVDVPADFQIGTDNVDREISETAGPQLVVPI
LNARFALNASNARWGSLYDALYGTDVIPETDGAEKGSSYNKVRGDKVIAYAKDFLDKAVP
LEQCSYTDVTKLAVVDGALQVTLDDGTTSTLADPSAFAGYRGEPDSPSSILLRHNGLYLD
IEIDPSSPIGQTDPAGIKDVVMESAITTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLS
EEVTKGGKTFTRVLNGNREYTAPDGTGFDLHGRSLLFVRNVGHLMTNDAILDADGNEVPE
GILDALFTSLIGMHGLTTDAGVQNSRTGSIYIVKPKMHGPDEVAFTVDLFGRVEKVLGLP
ENTLKVGIMDEERRTTVNLKACIKAAQDRVVFINTGFLDRTGDEIHTSMEAGAMIRKGEM
KKQKWIQAYEDFNVDTGLAAGLQHKAQIGKGMWAMTDLMADMVEQKIAQPKAGATTAWVP
SPTGATLHAMHYHLVDVFERQDEIAKRDPASVDDILTIPLAPRTDWSDEEKKEELDNNCQ
SILGYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWIHHDIVSADDVVAALE
RMAPVVDRQNEGDPAYRPMAPDFDASIAFQAAKELILEGAKQPSGYTEPILHRRRREVKA
AASA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccggatcactgtcgacggtttgcaggtctcttccgtcctctacgacttcatc
aacaacgaggctctgccggggaccggggtcgacaaggacgcgttctggtcgggtgcggcc
gccgtgatcgccgacctcgcgccccgcaaccgggacctgctggccgttcgtgacgatctg
caggccaagatcgaccagtggcaccgggaccacaggggcgagctcgacttcgacgcctac
aaggcgttcctgaccgagatcggctacctcgtcgacgtgcccgccgacttccagatcggc
accgacaacgtggatcgcgagatcagcgagaccgcgggaccgcagctggtggtgccgatc
ctcaatgcgcgtttcgcactcaacgcctccaacgcccgctggggttcgctctacgacgcg
ctgtacggcaccgacgtgatcccggagaccgacggcgccgagaagggcagctcgtacaac
aaggtgcgcggcgacaaggtgatcgcctacgccaaggacttcctggacaaggccgtgccg
ctcgagcagtgcagctacaccgatgtgaccaagctggccgtcgtcgacggcgccctgcag
gtcaccctggacgatggcaccacctctacgcttgccgatccgtccgccttcgccggttac
cgcggtgagccggactctccgtcgtcgatcctgttgcgccacaacggcctctatctcgac
atcgagatcgacccgtcgtcgccgatcgggcagaccgacccagccggcatcaaggatgtc
gtcatggagtcggcgatcaccacgatcatggacttcgaggactcggtcgccgcggtcgac
gccgacgacaaggtgctcggctaccgcaactggctgggcctcaacaagggcgacctgtcc
gaggaggtcaccaagggcggcaagaccttcacgcgcgtgctcaacggcaaccgcgagtac
accgcacccgacggcaccggcttcgatctacacggccggtcgttgctgttcgtgcgcaac
gtcggtcacctgatgaccaacgacgcgatcctcgacgccgacggcaacgaggtgcccgag
ggcatcctggatgcgctgttcacctcgctgatcggcatgcacggcctcaccaccgatgcc
ggcgtgcagaattcgcgtaccggctcgatctacatcgtcaagcccaagatgcacggcccc
gacgaggttgccttcaccgtcgacctcttcggtcgggtggagaaggtgctcggcctgccg
gagaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctcaag
gcctgcatcaaggccgcacaggaccgcgtggtgttcatcaacaccggcttcctggaccgc
accggcgacgagatccacacctcgatggaggccggcgcgatgatccgcaagggcgagatg
aagaagcagaagtggatccaggcctacgaggacttcaacgtcgacaccggtctggcggcc
ggactgcagcacaaggcgcagatcggtaagggcatgtgggcgatgaccgacctgatggcc
gacatggtggaacagaagatcgcccagcccaaggccggcgcgaccaccgcctgggtgccg
tcaccgaccggtgcgaccctgcacgccatgcactaccacctcgtcgacgtcttcgaacgg
caggacgagatcgccaaacgtgatccggcctcggtcgacgacatcctgaccatcccccta
gcaccacgcaccgattggagcgacgaggagaagaaggaagaactcgacaacaactgccag
tcgatcctcggctacgtggtgcggtgggtcgaccagggtgtcggctgctccaaggttccc
gacatccatgacgtcgcgctgatggaggaccgcgccacgctgcgcatctccagccaattg
ctggcgaactggattcaccacgacatcgtcagcgccgacgacgtggtcgccgcgctcgag
cggatggcgccggtggtcgaccgccagaacgagggcgacccggcctaccggccgatggcc
cccgacttcgatgccagcatcgccttccaggccgccaaggagctgatcctcgagggagcc
aagcagcccagcggctacaccgagccgattctgcatcgccgtcgccgcgaggtgaaggcc
gccgcatcggcctga

DBGET integrated database retrieval system