KEGG   Gordonia bronchialis: Gbro_2793Help
Entry
Gbro_2793         CDS       T01102                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00010  Glycolysis / Gluconeogenesis
gbr00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_2793
   00500 Starch and sucrose metabolism
    Gbro_2793
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Gbro_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ACY22010
UniProt: D0L919
Position
complement(2979949..2981370)
Genome map
AA seq 473 aa AA seqDB search
MTGWTTFPAGFLWGGATAANQIEGAFDADGKGLSIQDVLPRGILEPRTATPTPDNLKQIA
IDFYHRYAQDIALFAEMGFTVFRFSIAWSRIFPNGDDAEPNEAGLAFYDRVLDELERHGI
TPLVTISHYETPLAIAERYDGWVSREVIGLFERYVRVLFARYGHRVRYWLTFNEINSVLH
APFLSGGINTAPEKLSPSDLYQAIHHELVASALATRIAHETDPDIRVGCMVLGVPVYPLT
PAPADVEAALHTDHANLMFSDVHVRGRYPGYAERYFRDNGIRLHITDDDRELLAANTVDF
VSFSYYMSVCETADETRRTAREANLMGGVPNPYLASSAWGWQVDPTGLRIVLNQFWDRWN
KPLFIVENGLGAHDEVVEGPGGPTVLDDYRIEYLRDHLVEVGEAIADGVHVLGYCSWGPI
DLVSASTAQMSKRYGFIHVDRNDDGTGTLRRTRKKSFHWYAGVIATNGASLRS
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctggaccacgttccccgcaggcttcctgtggggcggtgcgactgccgccaat
cagatcgagggagccttcgacgcggacggcaaagggctctcgatccaggatgtcctgccc
cgcggcatcctcgaaccccgcaccgccacaccgactccggacaacctcaagcagatcgca
atcgacttctatcaccgctacgcccaggacatcgcgctgttcgccgagatgggtttcacg
gtgttccggttctccatcgcgtggagccgcatcttccccaacggcgacgacgccgaaccg
aacgaggccggccttgccttctacgatcgggtactcgacgaactcgagcgacacggcatc
accccactggtgaccatctcccactacgagacacccctggcgatcgccgagcgctatgac
ggctgggtctcgcgcgaggtcatcggactcttcgagcggtatgtgcgtgtgctgttcgcc
cgctacggccaccgcgtccgatactggttgacgttcaacgagatcaattcggtgctgcac
gctccgttcctgtccggcggtatcaacaccgcacccgaaaagctgtcgccgagcgacctc
taccaagcgatccaccacgaactcgtggcgagcgcgctggccacccgcatcgcgcatgag
accgatccggacatccgggtcggctgcatggtgctcggggttccggtctatccgttgaca
cccgccccggccgacgtcgaggcagcgctgcacaccgaccacgccaacctcatgttctcc
gacgtccatgtgcgcggacgttatcccggctatgcggaaaggtacttccgggacaacggg
attcgactgcacatcaccgacgacgaccgagagctgctggccgcgaacaccgtcgacttc
gtgtcgttcagctactacatgagcgtgtgcgagaccgccgacgagacccgtcgaacagcc
cgggaggcaaacctgatgggtggtgtgcccaacccgtacctggcctcctcggcctggggt
tggcaggtcgatcccaccggtctgcgcatcgtcctcaaccagttctgggaccgctggaac
aaaccgctgttcatcgtggagaacggcctcggcgcacatgatgaggtggtcgagggtccc
ggcggccccaccgtgctcgacgactaccggatcgagtatctgcgcgatcacctcgtcgag
gtcggtgaggcgatcgccgacggggtgcacgttctgggctactgctcctggggacccatc
gatctggtcagcgcctccaccgcgcagatgtccaagcgctacggtttcattcacgtcgac
cgaaacgacgacggcaccggaacgctgcggcgtacccgcaagaagtcgttccactggtat
gccggcgtcatcgcgaccaacggagcaagcctgcggtcctga

DBGET integrated database retrieval system