KEGG   Gordonia bronchialis: Gbro_2946Help
Entry
Gbro_2946         CDS       T01102                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gbr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gbr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gbr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3152716..3153543)
Genome map
AA seq 275 aa AA seqDB search
MSQAATASDAGVSSKLGPVFEKCRAEKRAALIGYLPVGFPTVDESLDSFRTMVEAGCDII
EVGVPYSDPVMDGPTIQDAADMALRNGVRVRDVFRAVETIASAGGSSVVMSYWNPVLQYG
VENFSRDLAAAGGAGLITPNLIPEEGAQWHAASDQYGLDRIYLVAPSSTTERIALTVDSS
RGFVYAASTMGVTGARDAVSDMAPELCRRVRDYADIPIGVGLGVRNREQAAEIAAYADGV
IVGSALVTAAKAGQDRLGALVAELAEGVRGHHDSA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggccgccaccgcatcggacgccggtgtctcctcgaaactcggtccggtcttc
gagaagtgccgtgccgagaagcgcgcagcgctgatcgggtatctgcccgtcggcttcccg
accgtggatgagtcgctggactcgttccggaccatggtcgaggccggctgcgacatcatc
gaggtgggcgtgccctactccgatcccgtgatggacggtccgacgatccaggacgccgca
gacatggccctgcgcaacggggttcgcgtgcgtgacgtcttccgcgcggtcgagaccatc
gcttcggcaggtggcagctcggtggtgatgagttactggaatccggtgctgcagtacggc
gtcgagaacttctcccgcgatctggccgcggccggcggggcggggctcatcacacccaat
ctcattccggaggagggtgcgcaatggcatgccgcctccgaccagtacggcctggaccgg
atctatctggtggcgccgtcatcgaccaccgagcggatcgcgctgaccgtcgactcctcc
cgcggcttcgtgtacgcggcgtcgacgatgggtgtgaccggcgcacgtgacgccgtctcc
gacatggcccccgaactgtgccggcgggtgcgtgactacgccgatatcccgatcggcgtg
ggcctcggtgtgcgcaaccgggaacaggccgccgagatcgccgcgtacgccgacggcgtg
atcgtgggctcggcgctggtcaccgccgccaaggccgggcaggaccgcctcggtgcactg
gtcgccgaactcgccgagggagtgcgtggccatcacgactcggcctga

DBGET integrated database retrieval system