KEGG   Gordonia bronchialis: Gbro_2946Help
Entry
Gbro_2946         CDS       T01102                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbro_2946
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_2946
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbro_2946
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gbro_2946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3152716..3153543)
Genome map
AA seq 275 aa AA seqDB search
MSQAATASDAGVSSKLGPVFEKCRAEKRAALIGYLPVGFPTVDESLDSFRTMVEAGCDII
EVGVPYSDPVMDGPTIQDAADMALRNGVRVRDVFRAVETIASAGGSSVVMSYWNPVLQYG
VENFSRDLAAAGGAGLITPNLIPEEGAQWHAASDQYGLDRIYLVAPSSTTERIALTVDSS
RGFVYAASTMGVTGARDAVSDMAPELCRRVRDYADIPIGVGLGVRNREQAAEIAAYADGV
IVGSALVTAAKAGQDRLGALVAELAEGVRGHHDSA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggccgccaccgcatcggacgccggtgtctcctcgaaactcggtccggtcttc
gagaagtgccgtgccgagaagcgcgcagcgctgatcgggtatctgcccgtcggcttcccg
accgtggatgagtcgctggactcgttccggaccatggtcgaggccggctgcgacatcatc
gaggtgggcgtgccctactccgatcccgtgatggacggtccgacgatccaggacgccgca
gacatggccctgcgcaacggggttcgcgtgcgtgacgtcttccgcgcggtcgagaccatc
gcttcggcaggtggcagctcggtggtgatgagttactggaatccggtgctgcagtacggc
gtcgagaacttctcccgcgatctggccgcggccggcggggcggggctcatcacacccaat
ctcattccggaggagggtgcgcaatggcatgccgcctccgaccagtacggcctggaccgg
atctatctggtggcgccgtcatcgaccaccgagcggatcgcgctgaccgtcgactcctcc
cgcggcttcgtgtacgcggcgtcgacgatgggtgtgaccggcgcacgtgacgccgtctcc
gacatggcccccgaactgtgccggcgggtgcgtgactacgccgatatcccgatcggcgtg
ggcctcggtgtgcgcaaccgggaacaggccgccgagatcgccgcgtacgccgacggcgtg
atcgtgggctcggcgctggtcaccgccgccaaggccgggcaggaccgcctcggtgcactg
gtcgccgaactcgccgagggagtgcgtggccatcacgactcggcctga

DBGET integrated database retrieval system