KEGG   Gordonia bronchialis: Gbro_2947Help
Entry
Gbro_2947         CDS       T01102                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gbr  Gordonia bronchialis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Gbro_2947
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Gbro_2947
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Gbro_2947
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Gbro_2947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3153540..3154907)
Genome map
AA seq 455 aa AA seqDB search
MTARAHSPSETGSRDDAALPAASVGLTTRTSLEPDEGGHFGVYGGRHVPEALMAVIDEVT
ATYLKMRTDEDYLAELDRLQRQYTGRPSPLYEATRLSDQAGGARIFLKREDLNHTGSHKI
NNVLGQALLAQRMGKTRIIAETGAGQHGVATATACALLGLECIVYMGRVDTDRQALNVAR
MRLLGAEVVAVDNGSATLKDAINEAMRDWVTNAHNTYYCFGTAAGPHPFPTMVRDLQRVV
GLEARAQILELAGRLPDAVVACVGGGSNAIGIFHPFIDDATVRLVGYEAAGDGVETGRHA
ATFTGGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDSGRAEYRPIT
DTEAMDALALLSRREGIIPAIESAHAVAGALKLGQELGEGQIIVVSLSGRGDKDVDTAAR
WFHLFDPPPSQDEAAQSPDAPTDPDAGHAQSGADR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgagcgcattcgccatccgagaccggcagtcgtgacgacgccgcactgccc
gcggccagcgtcggactgaccactcgtacctccctcgaacccgacgagggtggccacttc
ggtgtgtacgggggacggcatgtgcccgaggcgctgatggcggtcatcgacgaggtcacc
gccacctatctcaagatgcgcaccgacgaggactacctcgccgaactcgaccgactccag
cgccagtacaccgggcgcccgtcgccgctgtatgaggccacccgactgagcgaccaggcc
ggtggcgcgcggatcttcctcaagcgcgaggacctcaatcacaccggatcgcacaagatc
aacaatgtgctcgggcaggccctgctcgcgcagcggatgggcaagactcgcatcatcgcc
gaaaccggagccggtcagcacggcgtggcgaccgcgaccgcatgtgcgctactgggtctc
gagtgcatcgtctacatggggcgggtggacaccgaccggcaggccctcaacgtcgcgcgg
atgcggctgctcggggcggaggtggtggccgtcgacaacggatcggccacgctgaaggac
gcgatcaacgaggcgatgcgcgactgggtcaccaacgcgcacaacacctattactgcttc
ggcaccgcggccggaccccaccccttcccgacgatggtgcgcgacctgcagcgcgtcgtc
ggactcgaggcgcgcgcgcagatcctcgaactggccgggcggctgcccgacgccgtcgtc
gcctgcgtcggcggtggctccaacgccatcggcatcttccatccgttcatcgacgacgcg
acggtgcgcctcgtcggctacgaggccgccggcgacggggtggagaccggtcggcacgcg
gcgaccttcaccggtgggacgccgggtgccttccagggcgcctactcgtacctgctgcag
gacgaggacgggcagaccatcgaatcccattccatctcagcgggtttggactatccgggg
gtggggcccgagcacgcctacctcaaggacagcggacgcgccgagtaccggccgatcacc
gacacagaggcgatggacgcgctcgccctgctcagtcgccgcgaaggcatcatcccggcc
atcgagtccgcccacgcggtggcgggggcgctgaagctggggcaggaactcggcgagggc
cagatcatcgtcgtcagcctgtccggccggggtgacaaggacgtcgacaccgcggcccgg
tggttccacctgttcgatccgccgccctcgcaggacgaggcggcgcaatcgccggacgcc
ccaaccgatcccgacgccggtcatgcgcagtcaggagccgaccgatga

DBGET integrated database retrieval system