KEGG   Gordonia bronchialis: Gbro_3041Help
Entry
Gbro_3041         CDS       T01102                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00010  Glycolysis / Gluconeogenesis
gbr00052  Galactose metabolism
gbr00500  Starch and sucrose metabolism
gbr00520  Amino sugar and nucleotide sugar metabolism
gbr00521  Streptomycin biosynthesis
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01200  Carbon metabolism
Module
gbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_3041
   00052 Galactose metabolism
    Gbro_3041
   00500 Starch and sucrose metabolism
    Gbro_3041
   00520 Amino sugar and nucleotide sugar metabolism
    Gbro_3041
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Gbro_3041
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Gbro_3041
Enzymes [BR:gbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Gbro_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N TCR
Motif
Other DBs
NCBI-ProteinID: ACY22248
UniProt: D0LAV5
Position
complement(3255210..3256274)
Genome map
AA seq 354 aa AA seqDB search
MGELTIGIDIGGTSVRASVVDDHGVMLDTLRAATPPTAQALEHCLDRLVGELTSRWAAKA
VGLAIAGFLTPDRQMIRFAPHLPWREARVAEEMTRRIGIPVFAEHDANSAAVAEYRFGAA
ARGHNSLVLAIGTGIGAGLLIDGEIYRGSFGVAPELGHLTIVPDGRVCSCGKRGCWERYC
SGTALVDTVVELLADGNWGRSQLAADVAADPGSLTGRRVAGAAADGDAVALAAFAQFAAS
LGAGLAMIADIFDPDLIVLAGGVGAASGLFLDEAREHYARLVTGAGHRQLARIRGTQLGE
SAGVVGAAEVARQGLHARLAAAADPDDLVRQQTRPAPQPVSERVPDAAAGTVNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagttgaccatcgggatcgacatcggcggcaccagcgtccgcgcctcggtcgtc
gacgaccacggcgtcatgctcgacaccctgcgtgcggcgaccccacccacggcccaggcc
ctcgaacactgcctcgaccggctggtcggtgagctcacctcccggtgggcggccaaggcg
gtcggtctcgcgatcgccggtttcctgacacccgaccggcagatgatccggttcgccccg
catctgccgtggcgggaggcgcgggtcgccgaggagatgacccgccggatcggtatcccg
gtcttcgccgaacacgacgcgaactccgcggcggtggccgaataccggttcggagccgcg
gcccgcggccacaactcgctggtgctcgcgatcggcaccggcatcggcgcgggactgctc
atcgacggcgagatctatcgcgggagtttcggtgtcgcaccggaactgggacatctgacc
atcgttcccgacggccgggtgtgctcctgcggcaaacgtggctgctgggagcgctactgc
agtggcaccgccctggtggacacggtcgtcgaactcctcgccgacggcaactggggccgc
agccagctggccgccgacgtcgcagccgacccgggatcgttgaccgggcgtcgggtggcc
ggcgcggcggccgacggggatgcggtggcgctcgccgccttcgcccagttcgccgcctcg
ctgggcgcgggactcgcgatgatcgccgacatcttcgacccggacctgatcgtcctcgcc
ggcggtgtgggcgccgcgtcggggttgttcctcgacgaggcacgcgaacactacgcccgg
ctggtcaccggtgccggccaccggcagctggcccggatccgcggcacgcaactcggcgag
tcggccggtgtggtcggggccgccgaagtcgcccggcagggtctgcacgcccgactcgcc
gccgcggccgacccggatgatcttgtgcgccaacagactcgaccggcaccgcaaccggtg
tcggagagggtgcccgacgccgccgcggggacggtcaacccctga

DBGET integrated database retrieval system