KEGG   Gordonia bronchialis: Gbro_3062Help
Entry
Gbro_3062         CDS       T01102                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbr  Gordonia bronchialis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_3062
Enzymes [BR:gbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Gbro_3062
Peptidases [BR:gbr01002]
 Cysteine Peptidases
  Family C44
   Gbro_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3278571..3280511
Genome map
AA seq 646 aa AA seqDB search
MCGLLGLLTSDGSAAHAVDAVSSASHCMRHRGPDEPGTWHDDDLVFGFNRLSIIDIEHSH
QPLRWGPPEAPDRYALVFNGEIYNYVEIRAELARDEEAVFATEGDGEAIVAAFHYWGPDA
VRRLRGMFAFAIWDTVERSLFLARDPFGIKPLFLATGPGGTLFGSEKKSLLELIGRVVLD
GALDPWALDPRAIEHYTVLQYVPEPETLHASIRRLESGSHATLRPGQAPDIRRYFTPRFG
VHPFTDATRQSRYDEIAEVLADSVAKHMRADVTVGSFLSGGIDSTAIAALAIRHNPDLIT
FTTGFERDGYSEIDVAVESAEAIGARHVVKVVSEREFIDAIPQIVWYLDDPVADPALVPL
YFVAREARKHVKVVLSGEGADELFGGYTIYKEPLSLKGFDRLPGFLRRAAGRASDRIPEG
TRGKSLLHRGSLTLEERYYGNARSFDDARLRAVLRDYRPEWTHTDVTAPIYAMSEGWDPV
ARMQHVDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAIAERLPYDEKIAHGTTKY
ALRKALEQIVPAHVLHRKKLGFPVPIRLWLAETEMYDWAHEIIEHSQTDHILVKEAVVAM
LDEHRAGTVDNSRRLWTLLMFMVWHGIFVEKTIVPQITDHTYPVRL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggactgctcggcctgctgacatccgacggttcggcggcccatgccgtcgacgcc
gtctcatcggcctcgcactgcatgcgccaccgtgggcccgacgaaccgggcacctggcac
gacgacgatctcgtcttcggattcaaccggctgtccatcatcgacatcgaacactcccac
cagccgctgcgctggggcccgcccgaggcacccgaccggtatgccctggtcttcaacggt
gagatctacaactacgtggagatccgggccgagctcgcgcgcgacgaggaagccgttttc
gccaccgagggcgacggtgaggcgatcgtcgcggccttccactactgggggcccgacgcg
gtgcgtcgcctgcgcggcatgttcgccttcgcgatctgggacaccgtcgagcgcagtctg
ttcctcgcgcgcgatcccttcggtatcaaaccgctgttcctggcgaccgggccgggcgga
acgttgttcggcagtgagaagaagagcctgctggaattgatcggccgggtggttctcgac
ggtgccctcgatccctgggccctcgatccccgggccatcgagcactacaccgtcctgcag
tacgttcccgagccggagacgctgcatgcctcgatccgccggctcgagtccggttcccac
gccaccctgaggcccgggcaggcacccgatatccgacggtatttcaccccccggttcggc
gtgcacccgttcaccgacgccacccggcagtcgcggtacgacgagatcgccgaggtgctc
gcggactcggtcgccaagcacatgcgcgccgacgtcaccgtcggctccttcctgtccggc
ggaatcgactcgacggcgatcgccgcgctcgccatccgccacaaccccgacctgatcacc
ttcaccaccggcttcgaacgtgacggatattccgagatcgacgtcgccgtcgaatcggcc
gaggccatcggcgcgcgccacgtcgtcaaggtggtcagcgaacgcgagttcatcgacgcc
atcccgcagatcgtctggtacctcgacgaccccgtagccgaccccgcgctggtcccgctg
tacttcgtggcccgcgaggcccgtaaacacgtcaaggtcgtgttgtccggtgagggcgcc
gacgagttgttcggcggttacacgatctacaaagaaccgttgtcgctcaagggcttcgac
cggctgccgggctttctgcgccgcgccgccggccgggcgtcggaccgcatccccgaggga
acgcgcggcaagagtctgctccaccgcgggtcgctgaccctcgaggagcgctactacggc
aacgcgcgcagcttcgacgacgcgcgactgcgagccgtgctacgcgactatcggccggag
tggacccacaccgacgtcaccgcaccgatctacgcgatgagtgagggctgggatccggtg
gcgcgcatgcagcacgtggatctgttcacctggctacgcggcgacatcctggtcaaggcc
gacaagatcaccatggccaactcgctggaactgcgtgtcccgttcctggacccggaggtg
ttcgcgatcgccgaacgtctcccctacgacgagaagatcgcgcacggcacgacgaagtac
gcattgcgcaaggcgctcgaacagatcgtcccggcccatgtgctgcaccgcaagaagctc
ggcttccccgtaccgatccgcctctggctggccgagaccgagatgtacgactgggcccac
gagatcatcgagcactcccagaccgatcacatcctggtgaaggaggcggtggtggccatg
ctcgacgagcaccgcgccggcaccgtcgacaacagccgccggctgtggacgctgctcatg
ttcatggtgtggcacggcatcttcgtcgagaagacgatcgtcccccagatcaccgaccac
acctacccggtccgcctgtag

DBGET integrated database retrieval system