KEGG   Gordonia bronchialis: Gbro_3074Help
Entry
Gbro_3074         CDS       T01102                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gbr  Gordonia bronchialis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbro_3074
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbro_3074
  Amino acid metabolism
   00310 Lysine degradation
    Gbro_3074
Enzymes [BR:gbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gbro_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3291799..3293613
Genome map
AA seq 604 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AAEDDVVEVGGELALIGDADEAQDSGDDSGDDSSGGDEPTEAAPEPEPDEAAAEPSTDSD
APAEKPTADTGSGSAEGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVSTDKVD
TEIPSPVAGTLLEIVAEEDDVVEVGGKLAVIGDASAARSTPEPEPEPEPEPEPEPEPEPA
AEKKSEPAKSEPAKSESAKSESKPAESESKPAASKSEDPPTVESTPYVTPLVRKLAAEND
IDLNSIKGTGVGGRIRKQDVLAAAEAKKAPAPEPAAPAASSAPAASEKKASASPEIKPEL
AELRGTTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMTKIVGLRKAAKESFQASEGVN
LTFLPFIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTPQGLLSPVIHNADD
LSIPGLARAIADIAARARKGAGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLG
TGAIVKRPVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTVKKRLEGAAFAA
DLGL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgaaagcgtcaccgaggggacagtcacc
cggtggctgaaggaggagggcgacaccgtcgaggccgacgagccattgctcgaggtgtcg
acggacaaggtcgacaccgagatccccgcacccacctcaggtgtcctcaccaagatcatc
gcggccgaagacgacgtggtggaggtcggcggtgaactcgcgctgatcggtgacgccgac
gaggcgcaggactccggtgacgacagcggtgacgacagcagcgggggcgacgagcccacc
gaggcagcacccgagccggagcccgacgaagcggccgccgagccgtccaccgattccgac
gcgccggccgagaagcccacggccgacaccggatccgggtccgcggagggcaccgacgtg
ctcatgcccgagctcggcgaatcggtcaccgaaggcaccgtcaccaactggctcaaggcc
gtcggcgacgaggtcgccgccgacgaaccgctgctcgaggtctccaccgacaaggtcgac
accgagatcccctccccggtcgcgggcaccctgctcgagatcgtcgccgaggaggacgac
gtggtcgaggtcggcggcaagctcgccgtcatcggcgatgcgtcggcggccaggtccaca
ccggaacccgagccggaacccgaacccgagccggagcccgagccggaaccggaacccgca
gccgagaagaagtccgagccggcgaagtcagagcccgcgaagtcggagtcggcgaagtcg
gagagcaagccggccgagtccgagagcaagcccgccgcaagcaaatccgaggatccgccg
accgtcgagtcgaccccgtatgtgaccccgctggtccgcaagttggccgcggagaacgac
atcgacctcaactcgatcaagggcaccggtgtgggtggtcgcatccgcaagcaggatgtg
ctggccgcggccgaggccaagaaggccccggctcccgagcccgccgccccggccgcctcg
tcggccccggccgcttctgagaagaaggcgtcggcctcgccggagatcaagccggagctc
gccgagttgcgcggaaccacgcagaagatcaaccgcatccggcagatcaccgcgaagaag
acccgcgagtcgctgcagaccagcgctcagctcacccaggtcttcgaggtcgacatgacc
aagatcgtcgggctgcgcaaggcggccaaggagtcgttccaggcatccgagggcgtcaac
ctcaccttcctgccgttcatcgcgaaggccgtcgtggaggcgctcaaggcgcacccgaac
gtcaacgcgtcgatcgacgaggacaagaaggagatcacctactacgacaaggtgcatctc
gggatcgcggtggacaccccgcagggtctgctgtcgccggtcatccacaacgccgacgac
ctgtcgatccccggcctggcccgtgccatcgccgacatcgcggcccgcgcacggaagggt
gcgggcggtctcaagcccgacgagctggccggcggcaccttcaccatcaccaacatcggc
agccagggcgcgctgttcgacaccccgatcctggtcccgccgcaggcggcgatgctgggc
accggggcgatcgtcaagcgccccgtggtgatcaccggcgacgacggatcggagtcgatc
gccgtgcggtcgatgtcgtatctgccgctgacctacgaccaccggctgatcgacggcgcc
gacgccggccgcttcctcaccaccgtgaagaagcgactcgagggcgccgccttcgccgcc
gatctcgggctctag

DBGET integrated database retrieval system