KEGG   Gordonia bronchialis: Gbro_3074Help
Entry
Gbro_3074         CDS       T01102                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gbr  Gordonia bronchialis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbro_3074
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Gbro_3074
  Amino acid metabolism
   00310 Lysine degradation
    Gbro_3074
Enzymes [BR:gbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Gbro_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3291799..3293613
Genome map
AA seq 604 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLLEVSTDKVDTEIPAPTSGVLTKII
AAEDDVVEVGGELALIGDADEAQDSGDDSGDDSSGGDEPTEAAPEPEPDEAAAEPSTDSD
APAEKPTADTGSGSAEGTDVLMPELGESVTEGTVTNWLKAVGDEVAADEPLLEVSTDKVD
TEIPSPVAGTLLEIVAEEDDVVEVGGKLAVIGDASAARSTPEPEPEPEPEPEPEPEPEPA
AEKKSEPAKSEPAKSESAKSESKPAESESKPAASKSEDPPTVESTPYVTPLVRKLAAEND
IDLNSIKGTGVGGRIRKQDVLAAAEAKKAPAPEPAAPAASSAPAASEKKASASPEIKPEL
AELRGTTQKINRIRQITAKKTRESLQTSAQLTQVFEVDMTKIVGLRKAAKESFQASEGVN
LTFLPFIAKAVVEALKAHPNVNASIDEDKKEITYYDKVHLGIAVDTPQGLLSPVIHNADD
LSIPGLARAIADIAARARKGAGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLG
TGAIVKRPVVITGDDGSESIAVRSMSYLPLTYDHRLIDGADAGRFLTTVKKRLEGAAFAA
DLGL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgccctcggtgaaagcgtcaccgaggggacagtcacc
cggtggctgaaggaggagggcgacaccgtcgaggccgacgagccattgctcgaggtgtcg
acggacaaggtcgacaccgagatccccgcacccacctcaggtgtcctcaccaagatcatc
gcggccgaagacgacgtggtggaggtcggcggtgaactcgcgctgatcggtgacgccgac
gaggcgcaggactccggtgacgacagcggtgacgacagcagcgggggcgacgagcccacc
gaggcagcacccgagccggagcccgacgaagcggccgccgagccgtccaccgattccgac
gcgccggccgagaagcccacggccgacaccggatccgggtccgcggagggcaccgacgtg
ctcatgcccgagctcggcgaatcggtcaccgaaggcaccgtcaccaactggctcaaggcc
gtcggcgacgaggtcgccgccgacgaaccgctgctcgaggtctccaccgacaaggtcgac
accgagatcccctccccggtcgcgggcaccctgctcgagatcgtcgccgaggaggacgac
gtggtcgaggtcggcggcaagctcgccgtcatcggcgatgcgtcggcggccaggtccaca
ccggaacccgagccggaacccgaacccgagccggagcccgagccggaaccggaacccgca
gccgagaagaagtccgagccggcgaagtcagagcccgcgaagtcggagtcggcgaagtcg
gagagcaagccggccgagtccgagagcaagcccgccgcaagcaaatccgaggatccgccg
accgtcgagtcgaccccgtatgtgaccccgctggtccgcaagttggccgcggagaacgac
atcgacctcaactcgatcaagggcaccggtgtgggtggtcgcatccgcaagcaggatgtg
ctggccgcggccgaggccaagaaggccccggctcccgagcccgccgccccggccgcctcg
tcggccccggccgcttctgagaagaaggcgtcggcctcgccggagatcaagccggagctc
gccgagttgcgcggaaccacgcagaagatcaaccgcatccggcagatcaccgcgaagaag
acccgcgagtcgctgcagaccagcgctcagctcacccaggtcttcgaggtcgacatgacc
aagatcgtcgggctgcgcaaggcggccaaggagtcgttccaggcatccgagggcgtcaac
ctcaccttcctgccgttcatcgcgaaggccgtcgtggaggcgctcaaggcgcacccgaac
gtcaacgcgtcgatcgacgaggacaagaaggagatcacctactacgacaaggtgcatctc
gggatcgcggtggacaccccgcagggtctgctgtcgccggtcatccacaacgccgacgac
ctgtcgatccccggcctggcccgtgccatcgccgacatcgcggcccgcgcacggaagggt
gcgggcggtctcaagcccgacgagctggccggcggcaccttcaccatcaccaacatcggc
agccagggcgcgctgttcgacaccccgatcctggtcccgccgcaggcggcgatgctgggc
accggggcgatcgtcaagcgccccgtggtgatcaccggcgacgacggatcggagtcgatc
gccgtgcggtcgatgtcgtatctgccgctgacctacgaccaccggctgatcgacggcgcc
gacgccggccgcttcctcaccaccgtgaagaagcgactcgagggcgccgccttcgccgcc
gatctcgggctctag

DBGET integrated database retrieval system