KEGG   Gordonia bronchialis: Gbro_3237Help
Entry
Gbro_3237         CDS       T01102                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gbr  Gordonia bronchialis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Gbro_3237
   01230 Biosynthesis of amino acids
    Gbro_3237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_3237
   00030 Pentose phosphate pathway
    Gbro_3237
   00051 Fructose and mannose metabolism
    Gbro_3237
   00052 Galactose metabolism
    Gbro_3237
  Energy metabolism
   00680 Methane metabolism
    Gbro_3237
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Gbro_3237
Enzymes [BR:gbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Gbro_3237
Protein phosphatases and associated proteins [BR:gbr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Gbro_3237
Messenger RNA biogenesis [BR:gbr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Gbro_3237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3468022..3469056)
Genome map
AA seq 344 aa AA seqDB search
MAKRFGILTSGGDCPGLNAVIRGAVLKGETVYGHEFVGFKDGWYGLVYGDIMELDRTHVR
GLSNQGGTILGTSRFGPYTEPDGGPENIKKVLKNLEIDGVIAIGGDGTASAAKRLHGDGI
NIVGVPKTIDNDIDATDYTFGFNTAVEIATEAIDRLRTTGNSHKRCMVLEVMGRHAGWIA
LHSGIAGGAHAILIPEQPESLNQICAWVTSVRNRGRAPMVVVAEGFKLPDMKEEYSVKGL
DGFNRPRLGGIGEVLAPLIEERTGIETRATVLGHIQRGGVPTAWDRVLATRMGMAVADLV
AEGGWGQMVALHGTEINRITFDEAVGKLKQVPQDQYQEIRVIFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaggttcggcattctcacgtccggcggcgactgtcccggactgaacgcggtg
atccgcggtgcggtactcaaaggcgagaccgtctacggccatgagttcgtgggtttcaag
gacggctggtacggcctggtctacggcgacatcatggagctggaccgtacccacgtacgc
ggtctgtccaatcagggcggcaccatcctcggcaccagccgtttcggcccgtacaccgag
cccgacggtggaccggagaacatcaagaaggtgctcaagaacctcgagatcgacggcgtc
atcgccatcggcggagacggcaccgcgtcagccgccaaacggctccacggcgacggcatc
aacatcgtcggcgtccccaagaccatcgacaacgacatcgacgccaccgactacacattc
gggttcaacaccgcggtcgagatcgccaccgaggccatcgatcggttgcgcaccaccggc
aactcgcacaagcggtgcatggtcctcgaggtgatgggacggcacgccggctggatcgcc
ctgcattcgggtatcgccggcggtgcgcacgcgatcctcatcccagagcagccggagagt
ctcaaccagatctgcgcgtgggtcaccagcgtcaggaatcgcggtcgtgcgccgatggtg
gtggtggccgagggcttcaaactcccggacatgaaagaggagtactcggtcaagggactc
gacgggttcaaccgtccgcgactcggcgggatcggcgaggtgctggccccgctgatcgag
gagcgcaccggcatcgagacgcgcgccaccgttctcggacacatccagcgcggtggtgtg
ccgaccgcgtgggatcgggtgctcgccacccggatgggcatggcggtcgccgacctggtg
gccgagggtggctggggtcagatggtcgccctgcacggcaccgagatcaaccgcatcacc
ttcgacgaggcggtgggcaagctcaagcaggtgccgcaggaccagtaccaggagatccgg
gtcatcttcggctga

DBGET integrated database retrieval system