KEGG   Gordonia bronchialis: Gbro_3262Help
Entry
Gbro_3262         CDS       T01102                                 

Definition
(GenBank) Domain of unknown function DUF1957
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00500  Starch and sucrose metabolism
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbro_3262
Enzymes [BR:gbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Gbro_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1957 Glyco_hydro_57 Cuticle_2
Motif
Other DBs
NCBI-ProteinID: ACY22467
UniProt: D0LCX4
Position
3490850..3492418
Genome map
AA seq 522 aa AA seqDB search
MSFSDDSAVPGQFTLVLHSHLPWLANHGRWPVGEEWLYQSWAASYLPVVEVLNRLADDGF
HDQLSLGITPVLAAQLDDPHCCASMHTWLADWQLRACAATASPDPVRAEAGRREFVAAAT
ALDDFETRWRHGAAPVIRALAGAGVIEVLGGPLAHPFAPLLDPRLRRFSLSEGLADARAR
WGFDPAGIWAPECAFAPGMEDEYQRAGVRHFMVDGPTLHGDTALGRPVGDTDVVAYGRDL
SVSYRVWSPKSGYPGHAAYRDFHTYDHETGLKSSRVTGRSVPGDAKKPYDPDRVDAVIDR
HVDDFVDHVRRRLQAESERIGRPALVVAAFDTELFGHWWFEGPRWLERVLRRLPEAGVRV
GTLAQAAQNGFVGDAVTLPASSWGSGKDWRVWDGPQVRHLVDLNAEVTETALDTVTKLLE
GGRGERHRVADQILRETLLTVASDWPFMVSKDTAAHYAVQRAHTHAHATREICDAAMRGR
DADAARLAAGWQRADNLFAGLDARRLRVTDSGGRAGRTGGDG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttctctgacgattcggccgtgcccggccagttcaccctggtcctgcactcccac
ctgccctggctggccaatcacggccgctggccggtcggtgaggagtggctgtatcagtcg
tgggccgcgtcgtatctgcccgtcgtcgaggtgctgaatcgcttggccgacgacggtttt
cacgaccagctgtccctcggcatcaccccggtgctggccgcccagctcgacgacccgcac
tgctgcgcctcgatgcacacgtggctggccgactggcagctgcgggcgtgcgcggccaca
gcgtcgcccgatccggtccgggccgaggccggccggcgcgaattcgtcgcggcggcaacg
gctctcgacgacttcgagacgcggtggcggcacggcgcggccccggtgatccgggcgctg
gccggtgccggggtgatcgaggtgctcggcggaccgctggcccatccgttcgccccgctg
ctcgacccccgtctgcggcggttctcgctctcggaggggcttgccgacgcccgggcacgc
tggggattcgacccggcgggcatctgggcaccggaatgcgcgttcgcccccgggatggag
gacgagtaccagcgggccggggtgcggcacttcatggtcgacggcccgacgctgcacggc
gacaccgctctcggccggcccgtcggcgacaccgacgtcgtcgcctacgggcgcgacctc
agcgtcagctatcgggtgtggtcgccgaagtcgggctatcccgggcacgccgcctaccgc
gacttccacacctacgaccacgagaccgggttaaagagttcccgggtgaccggacggtcg
gtgcccggtgacgccaagaagccctacgaccccgaccgcgtcgacgccgtcatcgaccgg
cacgtcgacgacttcgtcgatcatgtgcggcgtcgtctgcaggcggagtccgagcgcatc
ggccggcccgcgctagtggtggccgccttcgacacggaactgttcggacactggtggttc
gagggtccccgctggctggagcgggtgctgcgacggctgccggaggcgggtgtgcgcgtc
ggcaccctcgcgcaggcagcgcagaacggattcgtcggtgacgcggtcaccctgcccgcg
tcgtcgtgggggtcgggcaaggactggcgtgtctgggatggcccgcaggtgcggcatctg
gtcgacctcaacgcggaggtcaccgagaccgcgctcgacaccgtcaccaagctgctcgag
ggcggccgcggcgaacgtcaccgcgtggccgatcagatcctgcgggaaacgctactgacg
gtggcctcggactggccgttcatggtctccaaggacaccgcggcgcattacgctgtgcag
cgggcacacacacatgcgcacgccacccgggagatctgcgacgcggcgatgcgcgggcgg
gatgccgacgcggcccggctggccgcgggatggcagcgtgcggacaacctgttcgcggga
ctggatgcgcgtcgacttcgggtcaccgattccggtgggcgcgcaggaagaacggggggc
gacgggtga

DBGET integrated database retrieval system