KEGG   Gordonia bronchialis: Gbro_3450Help
Entry
Gbro_3450         CDS       T01102                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gbr  Gordonia bronchialis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Gbro_3450
  Lipid metabolism
   00561 Glycerolipid metabolism
    Gbro_3450
   00600 Sphingolipid metabolism
    Gbro_3450
Enzymes [BR:gbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Gbro_3450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3669506..3670747)
Genome map
AA seq 413 aa AA seqDB search
MWSRLVAVALFVVVAVVVVAGCGEPTSRLGGDAPAIGGLPDVAPMGWNSWNTFGCGVTEA
DVHAQADALVSSGLRDAGYRYVVIDDCWSATTRDGQGRLVADPVTFPSGMAAMGRYLHQR
GLKFGIYAGAATQTCAQLLGNRAGSTGSEGHEQIDARTFAEWGVDYLKYDWCATDADHDR
QLTAFTAMRDALRSVGRPIVYNINPNSGITDGAVPGAMYDWGGVATMTRLSNNVIASWQT
GAGPAGQRGVVDEIDAAAPLTDRVQPGAFLDPDALVVGLGNLTPAMGRTQMAMWAMLAAP
LIASCDLTTMSPDTLRTLRSAAVIALDQDADVRAGRPVDDNPEIWQRGLRHGVAVSLTNR
DSHPRTMAVRLSDLDLPESTTFTDAWSGRAVSTTDGWVSVLVAAHDTALLTAG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtcccggctggtcgcggtcgccctgttcgtggtggtcgcggtcgtggtggtcgcg
ggctgcggtgaacccacgtcgcgtctcggcggtgacgcaccggcgatcggcgggctgccc
gatgttgcgccgatgggatggaacagctggaacaccttcggttgtggcgtcaccgaagcc
gacgtgcacgcccaggccgacgccctcgtctccagcggtctgcgtgacgccggataccgc
tatgtggtgatcgacgactgctggtcggcgacgacccgtgacgggcaggggcgcctggtc
gccgacccggtcacgttcccgtcgggaatggctgcgatgggacgctacctgcatcaacgt
ggcctgaagttcgggatctacgccggtgccgccactcagacgtgtgcgcagttgctgggc
aaccgggccgggagcaccggcagcgagggccacgaacagatcgacgcgcgcaccttcgcc
gaatggggtgtcgactatctgaagtacgactggtgcgccaccgatgccgaccacgatcgg
cagctgacggcattcacagcgatgcgcgacgcactgcggtcggtcggccggccgatcgtc
tacaacatcaaccccaacagcgggatcaccgacggtgcggtgcccggcgcgatgtacgac
tggggcggcgtggcgacgatgacgcggctgtcgaacaatgtcatcgcgtcctggcagacc
ggcgccggtccggccggtcagcggggcgtcgtcgacgagatcgatgccgcggcaccgctt
accgaccgggtgcaacccggtgcgttcctcgaccctgatgcgctcgtcgtaggtctgggg
aacctgacgccggcgatgggacgaacccagatggcgatgtgggcgatgctggccgcgccg
ctcatcgcgtcatgcgacctgacgaccatgagcccggacacgctgcgcaccctgcggtcg
gcggcggtgatcgctctcgaccaggatgccgacgttcgtgccgggcgaccggtggacgac
aacccggaaatctggcagcgcggcctgcggcacggcgtcgcggtcagcctgaccaaccgc
gacagtcatccgcgcaccatggcggtccgcctctctgacctggatctgccggagtcgacg
acgttcaccgacgcgtggtcggggcgggcggtttcgaccaccgacgggtgggtctcggtc
ttggtcgctgcccatgacacggcgctgctgacggctgggtga

DBGET integrated database retrieval system