KEGG   Gordonia bronchialis: Gbro_3505Help
Entry
Gbro_3505         CDS       T01102                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gbr  Gordonia bronchialis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gbro_3505
Enzymes [BR:gbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Gbro_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3727007..3728140)
Genome map
AA seq 377 aa AA seqDB search
MLPLAGFTIGVTAARRADEFAALLVRRGAQVMHAPTIRILPLLDDTELERVTTELIADPP
EIMVATTGIGFRGWVEAADGWGNAEDVLAALGKSRLIARGPKAKGAIRAAGLREEWSPES
ESSSEVLDRLLAEGVDGVRIAVQLHGATSEWEPLPDFCTVLRAAGAQVVPIPVYRWNMHP
DVDSIDKMIMAVVRGDLDALTFTSAPAAAAILTRAKQLGKLQQFIHALRTAVPVMCVGSV
TASPLEALQIPTIYPRRFRLGALARLITDELPRRSHVLRVAGHDTAIRGQAVLVDGSVRE
LSATSLILLKILAGVPGRVVSRQELLGGLPGDSSDTHAVEVAVARLRSALGDPKMIQTVV
KRGYRLAVDLEYDGETT
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgctggccggattcaccatcggcgtcaccgcggcccgccgggccgacgagttc
gccgcgctgctcgtgcggcgcggtgcgcaggtgatgcacgccccgaccatccgcattctg
ccgctgctcgacgacaccgaactcgaacgcgtcaccaccgagctgatcgccgatccgccc
gagatcatggtggccaccaccggcatcggctttcgtggctgggtcgaggcggccgacggt
tggggtaacgccgaagacgtgctcgcggcgctgggcaagagtcgcctgatcgcccgtggc
cccaaggcgaaaggcgccatccgcgccgccgggctgcgcgaggagtggtcgccggagagc
gaatcatcgtcggaggtgctcgaccggcttctcgccgagggtgtcgacggggtgcggatc
gccgtgcagttgcacggcgccaccagtgagtgggagccgctgccggatttctgcacggtg
ctgcgtgccgcgggtgcgcaggtcgtcccgatcccggtgtatcgctggaacatgcatccg
gatgtggactcgatcgacaagatgatcatggcggtggtgcgaggcgatctcgatgccctc
accttcaccagcgcccccgccgccgcggcgatcctcacccgggccaagcaactcggcaaa
ctgcagcagttcatccatgcgctgcgcaccgcggtgccggtgatgtgtgtggggtcggtg
accgcgagtccccttgaggcactccagatcccgaccatttatccgcggcgcttccggctc
ggtgcgctggcccggctgatcaccgacgaactgccgcgtcgcagccacgttctgcgggtg
gccggacacgacaccgccatccgcggacaagccgtgctggtcgacggatcggtgcgcgaa
ttgtcggccaccagtctgatcttgctgaagatcctggccggggtcccggggcgggtcgtg
tcgcgccaggaactgctcggcggactgccgggtgacagttccgacacccacgcggtggag
gtggcggtggcccggctgcgctcggcgctgggtgatcccaagatgatccagaccgtggtc
aagcgcggctaccggctcgccgtggatctcgaatacgacggggagacaacgtag

DBGET integrated database retrieval system