KEGG   Gordonia bronchialis: Gbro_3525Help
Entry
Gbro_3525         CDS       T01102                                 

Definition
RNA polymerase sigma-70 factor
Orthology
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
gbr  Gordonia bronchialis
Brite
Transcription machinery [BR:gbr03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Gbro_3525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3748443..3749330)
Genome map
AA seq 295 aa AA seqDB search
MTTPVMNASARAVPIGTAAIGDVTVRIPEIPTPETPTPGHVGSASVNLSERLQLKSFDSL
PEAGTQVLTEGIVVAEPESTDRTAPRRADPNETPEQLTERFERDALPLLDQMYGAALRMT
RNPSDAEDLVQETYVKAFTAFASFREGTNLKAWLYRILTNTYINGYRKKQRQPAQYPTDE
ITDWQLAATAEHTSTGLRSAEIEALDALPDDEIKAALQELPEEFRMAVYYADVEGLPYKE
IAEIMDTPIGTVMSRLHRGRRQLRELLADVARERGFNRKRADDTSDTVSDAGVAR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccggtgatgaacgcttcggcgcgcgctgtgcccatcggcaccgcagccatc
ggtgacgtgacggtgcggatacccgagatcccgacccccgagaccccgacccccggccac
gtcggatccgcatcggtaaacttgtcggagcgcctgcagctgaagtcgttcgactccctg
ccggaagccggtacacaggtactcaccgaagggatcgtagtggccgaacccgagtcgacc
gatcgcactgcgcctcggcgcgccgatccgaacgagacacccgagcagctcaccgaacgt
ttcgagcgcgacgctctgccgctgctcgatcagatgtacggcgctgcgttgcggatgacc
cgcaacccctccgacgccgaggacctggtgcaggagacctacgtgaaggcgttcaccgcc
ttcgcctcattccgggagggcaccaacctcaaggcgtggctctaccggatcctcaccaac
acctacatcaacggttaccgcaagaagcagcgtcagccggcgcagtacccgaccgacgag
atcaccgactggcagctcgccgcgaccgccgagcacacctccaccggattgcgatccgcg
gagatcgaggccctcgacgcactgcccgacgacgagatcaaggccgctttgcaggaactc
cccgaggagtttcgcatggcggtctactacgccgacgtcgaaggtctgccgtacaaggag
atcgccgagatcatggacacgcccatcggaacggtgatgtcacgcctgcaccgcggacgc
cggcagctgcgggaactgctcgccgatgtcgcgcgggaacgcggattcaatcgcaaacgg
gccgacgacaccagcgacacggtctcggatgcgggggtggcacgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system