KEGG   Gordonia bronchialis: Gbro_3529Help
Entry
Gbro_3529         CDS       T01102                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gbr  Gordonia bronchialis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Gbro_3529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gbro_3529
  Lipid metabolism
   00071 Fatty acid degradation
    Gbro_3529
  Amino acid metabolism
   00350 Tyrosine metabolism
    Gbro_3529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Gbro_3529
   00626 Naphthalene degradation
    Gbro_3529
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Gbro_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3751335..3752306)
Genome map
AA seq 323 aa AA seqDB search
MRLCDKDQPLPGPDELLVRVRACGVCRTDLHVAEGDLPVHRSGVTPGHEVVGEVVESGSQ
VSDFAPSDRVGVAWLHRTDGACRYCLRGDENLCPSSLYTGWDIDGGYAEYTTVPAAFAYR
LPEGIDDVDLAPLLCAGIIGYRALRRTGILDPTRGAQSPKRLGLYGFGGSAHLCAQLAIA
LGVEVHVFTRGEKSRQLARDLGAASVAEVYDDPPVPLDAAITFAPVGKLVPVALRGLDRG
GVLSIAGIHLSDIPTLNYERELFYEKEIRSVTANTRQDGTDFLDLAARHGVRATTHAYPM
DSAPQALADLKAGRFDGAAVLVV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtgcgacaaggaccaaccccttcccgggccggacgagttgcttgtccgggtc
cgcgcgtgtggggtctgccgcaccgatctgcacgtggccgagggggacctgccggtacat
cggtcaggggtgaccccgggtcacgaggttgtcggtgaggtggtcgagtccggttcgcag
gtgagtgatttcgcgccgagcgaccgcgtcggggtggcgtggttgcaccggaccgatggc
gcctgtcggtattgtcttcgcggcgacgaaaacctctgtccttcgtcgctgtacaccggc
tgggacatcgatggcggctacgccgagtacacgacggtgcccgccgcgttcgcctatcgc
ctacccgagggcatcgatgatgtggatctcgccccgctgctgtgtgcgggcatcatcggc
taccgggccctgcgacgaacggggatactcgatccgacgcgcggtgctcagagtccgaag
cgtctgggtctctacggtttcggcggaagtgcccacctgtgtgcacagctggcgatcgca
ctcggtgtcgaggtacacgtcttcacccgtggggagaagtcgcggcagctggctcgcgac
ctgggtgccgcgtcggtggcggaggtctacgacgatccgccggtaccgctggatgccgcg
atcacgttcgccccggtcggaaagctggtgccggttgcgttgcgcggactggaccggggc
ggtgtcctgtccatagcgggaatccatctcagcgacatccccaccctcaattacgaacga
gagctgttctacgaaaaagaaatccggtcggtgaccgccaacacgcggcaagacggcacc
gacttcctcgacctcgccgcgcgacacggcgtgcgtgcgaccacacacgcctacccgatg
gactccgcgccgcaggcgctcgccgacctcaaagcgggccgcttcgacggggcggccgtg
ctggtggtctga

DBGET integrated database retrieval system