KEGG   Gordonia bronchialis: Gbro_3533Help
Entry
Gbro_3533         CDS       T01102                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gbr  Gordonia bronchialis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gbro_3533
Enzymes [BR:gbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Gbro_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3756461..3758626)
Genome map
AA seq 721 aa AA seqDB search
MGGGDVDGSVPDGRLAELARRWGVATEYVGADRLTHRVSAETLIAVLDALGVAAQDAERV
EKAIVAIDERQWREFLPPVVVVTEGGGTFTVHVPHGDPVDVGIVTEAGEARTPEQLDIWV
DPREIDGVLIGRASFAVPADLEPGYHRIKVINLRDTSTASTSLIVTPARLTTADRLLGHQ
RWGLAVQLYSVRSARSWGVGDFADLRGICEVAGSSYGADFVQVNPLHAAQPQPPLENSPY
LPTTRRFVNPLYIRVTDIPEISGLNKQQRKWCKVVERAFFDENMSAQLIKRDKSFAAKME
CLELIFGVPRSGRRRAAYREFRRREGKGLRRFATWCALAERYPEGDRRWATKLRDKDHVK
AKRRKLKRRIEFYTWLQWICDEQLAAAQQAALSAGMSVGVIADLAVGVARHSADTWTLGD
VLAAGATVGAPPDAFNQQGQGWDQPPWHPRRLAEAGYEPYRDMLRTVLRHAGGLRVDHIL
GLFRLWWIPDGRGPAHGTYVHYDHDALIGILALEAQRADAVVIGEDLGVFEPTVQQTLTE
RGILGTSILWFEHGPYAPIPPEDYRELCLTSVTTHDLPPTAGYLAGDHIELRSALGLLET
DEATERARDERDRDAIIDLARARGLLDVDGDPTDPANIPATIDALYALIAASPSVLLSVA
LVDAVGERRIQNQPGTDATQYPNWCIPLADSGQNVVLVEDLIGVARFRNLVGALEEAGVG
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
gtgggtggcggtgacgtggatggctcggttcccgacggccgactggccgaactggcccgc
cggtggggcgtggcgaccgagtacgtcggtgccgatcggctgacccatcgggtgagcgcc
gagacgctgatcgccgtgctcgacgcgctcggtgtcgcggcgcaggacgccgagcgcgtc
gagaaggcgatcgtggcgatcgacgagcggcaatggcgggagttcctcccacccgtcgtc
gtggtcaccgaaggtggtggaacgttcacagtccatgtgccgcacggtgatccggtcgat
gtcggcatcgtcaccgaggccggcgaggctcgcacaccggagcagctcgacatctgggtg
gacccgcgtgagatcgacggtgtcctgatcggacgggccagttttgcggtgccggctgat
ctcgagcccggctaccaccgcatcaaggtgatcaatctgcgtgacacgtccaccgccagc
acctccctgatcgtcacgccggcaaggctcacgactgccgatcgcctgttgggtcaccaa
cgatggggactcgcggtccagttgtactcggtgcgttcggcgcgatcctggggcgtcggt
gacttcgcagacctgcggggaatctgcgaggtagcgggcagcagctacggtgccgacttc
gtccaggtcaacccgctgcacgccgcgcaacctcaaccgccgctggaaaactcgccctac
cttcccaccacgcggcggtttgtcaatccgctctacatccgggtcaccgacatccccgag
atcagtggcctgaacaagcaacagcgcaagtggtgcaaggtggtcgagcgcgccttcttc
gacgagaacatgtcggctcaactcatcaagcgcgacaagtcctttgccgccaagatggaa
tgtctggaactcatcttcggggtgccgcgcagcgggcggcgccgcgccgcgtaccgcgag
ttccgtcgccgcgagggcaaggggctgcgccggttcgcgacgtggtgtgcgctggccgag
cgctatcccgagggcgaccgccggtgggcgacgaagttgcgcgacaaggaccatgtgaag
gccaaacgcagaaaactcaagcgccgcatcgagttctacacctggttgcaatggatttgc
gacgagcaactcgccgcggcccaacaggccgcgctgtcggccgggatgagtgtcggcgtg
atcgccgacctcgccgtcggggtggcccggcacagcgccgacacctggacgctgggcgac
gtcctggccgccggcgccaccgtcggcgccccacccgacgcgttcaatcagcaggggcag
ggctgggatcagccgccgtggcatccgcgtcgactcgccgaggccggctacgagccctac
cgggacatgctgcgcacagtactgcgccatgccggtggtcttcgcgtcgatcacattctc
gggctgttccggttgtggtggattcccgatggccggggtcccgcgcacggcacctacgtg
cactacgaccacgatgcgctgatcggcatcctcgcgctggaggcgcaacgggccgacgcc
gtggtcatcggcgaggacctcggggtgttcgagccgactgtgcagcaaaccctcaccgag
cgcggcatcctgggtacctcgatcctgtggttcgaacacggcccgtacgcgccgatccca
cccgaggactaccgcgaactgtgtctgacctcggtcaccacgcacgacctaccgccgacg
gccggttaccttgcaggtgatcacatcgaattgcgttctgccctgggcctgttggagacc
gacgaggcgaccgaacgggcgcgcgacgaacgtgaccgggacgcgatcatcgacctcgcg
cgggcgcgaggcctgctcgatgtcgacggcgacccgaccgacccggcgaacatcccggcg
acgatcgatgcgctctatgcgctgatcgcggccagcccgtcggtgctgctgagcgtcgca
ctggtggatgcggtgggggagagacggattcagaatcagccgggcaccgacgccacccag
taccccaattggtgtatcccgctcgccgattccgggcaaaacgtcgtcctggtggaggat
ctcatcggcgtcgcccggttccgcaacctggtgggtgcgctcgaggaggccggcgtcgga
cgctga

DBGET integrated database retrieval system