KEGG   Gordonia bronchialis: Gbro_3766Help
Entry
Gbro_3766         CDS       T01102                                 

Definition
asparagine synthase family amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gbr  Gordonia bronchialis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gbr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4047885..4049684
Genome map
AA seq 599 aa AA seqDB search
MCGICGEIRFDGSAADVAAVDDMTCSMTRRGPDANGVFAKGPVALGHRRLKIIDLSERGS
QPMVDPELGLALVFNGCIYNHRELRAELEGKGYRFFSHADSEVILKAFHAWGAHCVDHLL
GMFAFAVVETDTGTVTLARDRLGIKPLYLAERPGRLRFASSLQALLRAGEVDTSIDRVAL
HHYFSFHAVVPAPHTIYNGVRKLPPGTVRTITPDGRSTEFRYWTPSFEPHPDRADWDERR
WQHELVDSLRTSVRRRMVADVPVGVLLSGGIDSSLVVALLAEQGQTDLATFSIGFDSVGG
ESGDEYAYSDIIADTFGTDHHKIHIGTERLLPAVPDAIAAMSEPMVSHDCVAFYLLSEEV
SKSIKVVQSGQGADEILGGYSWYPPLRNTPREETTKAYANVFFDRTHAEIGALLDDAYLL
SDSDYDPSWEFVRAHNAAPGADTAVDAALRLDTTIMLVDDPVKRVDTMTMAWGLEARVPF
LDHEFVELAATCPPDLKLAHGGKGVLKEASRKLLPSAVIDRTKGYFPVPGIRHLEGGVFD
LVADTLNSQSARDRGLYRGAALDRLFADPNGYRTPLGGNELWQVALLEMWLQTMESSRR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctgcggagagatccgcttcgacggcagcgcggccgatgtcgccgcggtg
gacgacatgacctgctcgatgacgcgccgcgggcccgacgccaatggcgtgttcgccaag
gggccggtcgccctgggacatcggcgcctcaagatcatcgacctgtccgagcgcggcagc
cagccgatggtcgaccccgagttgggactcgcactggtcttcaacggctgcatctacaac
caccgcgaactgcgtgccgagctcgagggcaagggttaccgcttcttctcgcatgccgac
agcgaggtgatcctcaaggcctttcatgcgtggggagcccattgtgtggatcatctgctc
gggatgttcgccttcgccgtcgtcgagaccgacacaggcaccgtgaccctggcgcgtgat
cgtctcgggatcaaaccgctctatctggccgagcgtccgggccgattgcggttcgcgtcg
tcgttgcaggcgttgctgcgcgccggtgaggtcgacaccagcatcgaccgcgtcgccctg
caccactacttcagcttccatgccgtggtaccggcgccgcacaccatctacaacggtgtc
cgcaaactgcccccgggcaccgtccgcaccatcacacccgatggccgatccaccgaattc
cgttattggacaccgtcgttcgagccccatccggatcgggcggactgggatgagcggcgc
tggcagcacgagctggtggattcgctgcgcacctcggtccgccgccgcatggtcgccgac
gtcccggtgggtgttctgctctccggcggcatcgactcgtcgttggtggtggcgttactc
gccgagcaggggcagaccgatctggccaccttcagcatcggattcgattccgtgggaggc
gaatccggcgacgagtacgcctactccgacatcatcgccgacaccttcggcaccgaccac
cacaagatccacatcggcaccgagcgcctcctgcccgcggttcccgacgccatcgccgcc
atgagtgagccgatggtgagccacgactgtgtcgccttctatctgctctccgaggaagtc
agcaagtccatcaaggtggtccagtccgggcagggcgccgacgagatcctcggcgggtac
agctggtatccgccgttgcgcaacactccgcgggaggagaccaccaaggcgtacgcgaat
gtgttcttcgatcgcacgcacgccgagatcggcgctctgctcgacgacgcctacctgctc
agcgactccgactacgatccgagctgggaattcgtgcgcgcccacaacgcggcgcccggc
gccgacaccgccgtcgacgccgccctgcgcctcgacaccaccatcatgttggtcgacgac
ccggtcaaacgcgtggacaccatgacgatggcgtgggggctcgaggcgcgagttccgttc
ctggaccacgaattcgtcgaactcgcggccacctgcccacccgacctgaaactcgcccac
ggcggcaagggtgtgctcaaggaggccagccgaaagctgctgccgtcggcggtgatcgac
cgcaccaagggctacttcccggtgcccggcatccgccacctcgagggtggcgtcttcgat
ctggttgccgatacgttgaactcgcagtccgcgcgcgaccgcggtctctatcggggggcc
gccctcgaccgtctctttgccgaccccaatggataccgaaccccgttgggcggcaacgaa
ctctggcaggtcgccctcctggagatgtggctgcagaccatggagtcgtcgcgcagatga

DBGET integrated database retrieval system