KEGG   Gordonia bronchialis: Gbro_3962Help
Entry
Gbro_3962         CDS       T01102                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
gbr  Gordonia bronchialis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Gbro_3962
  Amino acid metabolism
   00380 Tryptophan metabolism
    Gbro_3962
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Gbro_3962
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Gbro_3962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4258943..4260403
Genome map
AA seq 486 aa AA seqDB search
MPTLRARWIRNSWSGHQFPHPGKRRPFIGDLGVSDPRNPILSVLALGTQFGGIYELKVFR
QKFVFVASAELTAELCDETRFCKTLPPAIAALRDYGGDGLFTAYTTEPNWQLAHDLLMPA
FTKPAMRSYHRIMLDTAAELFAYWDAIPGGRVDVTRDMTKLTMETLSRAAFSRDFGSFTT
PRPHPFVQSMITALRTSRRKGALRTAPGGRLYGRYLAHRAAPVTDYAYEMVDEMIADRVD
GPHRDDLLGIMLKVRHPETGERLSRLNMRYQILTFLVAGHETTSGALSFTLYFLSQNPEC
LRRAQREADEILGTDPDAEPTFEQVSKFRYIRRCLDESLRLWPTVPAFSRRPVADTVLAG
KYPMRSQDWALIMLGQVHRDPAVWENPETFDPDRFLPEEIRKRPAHSYKPFGTGMRACIG
RQFALHESVLVLARLVHRYDITPDADYRLDVTERLTMAPKNFHINLTPRRATPASRACGS
APGHAR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctccgcgctcgttggatccgcaacagctggtccgggcatcaattcccgcat
cccggtaagcgcagaccgttcatcggcgacctcggcgtctccgacccgcgcaacccgatt
ctgagcgtgctcgcactgggtacccaatttggcggcatctacgagctgaaggtcttccga
cagaagttcgtcttcgtggcatcggcggaactgaccgccgaactctgcgacgagacccgc
ttctgcaaaaccctgccgccggccatcgcggcactacgcgactacggcggcgacggtctg
ttcaccgcgtacaccaccgaaccgaactggcaactcgcccacgatctgctcatgcccgcg
ttcaccaaacccgccatgcgcagctatcaccgcatcatgctggacacggctgccgaacta
ttcgcctactgggacgcgatacccggcgggcgggtcgatgtcacccgcgacatgaccaag
ctgaccatggagacgctgagccgggccgcgttcagccgcgacttcggctcgttcaccacc
ccgcgcccgcacccgttcgtgcagtcgatgatcaccgccctgcggacctcacgccgcaag
ggcgcgttacggaccgcccccggcggccggctctacgggcgctacctggcacaccgcgcg
gcgccggtgaccgattacgcctacgagatggtcgacgagatgatcgccgaccgggtggac
ggtcctcatcgcgacgacctcctcggcatcatgctcaaggtgcgccacccggagaccggt
gaacggctctcgcgtctcaacatgcgctatcagatcctcacctttctggtggccgggcac
gaaaccacttccggcgcactgtcgtttacgctctatttcctgtcgcagaatcccgagtgc
ctgcgacgggcgcagcgggaggccgacgagatcctcggcaccgatcccgatgccgaaccg
accttcgagcaggtgtcgaaattccgctacatccgtcgctgcctcgacgagtcactgcgc
ctgtggcccaccgtgccagccttctcccgacggcccgtcgccgacaccgtcctggcgggc
aaataccctatgcgcagccaggattgggcgctcatcatgctcgggcaggtacaccgcgat
ccggccgtatgggagaaccccgagaccttcgacccggatcgctttctccccgaagagatc
aggaagcggcccgcgcacagctacaaaccgttcggcaccgggatgcgggcctgcatcgga
cggcagttcgcgctgcacgagtcggtactggtgctcgcgcgcctcgtgcatcgctacgac
atcacccccgacgccgactaccggctcgacgtcaccgagcgtctcaccatggcgcccaag
aactttcacatcaatctgactccccgccgggctacaccagcgtcccgagcatgcggatct
gcgccgggtcacgcgcggtga

DBGET integrated database retrieval system