KEGG   Gordonia bronchialis: Gbro_4015Help
Entry
Gbro_4015         CDS       T01102                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gbr  Gordonia bronchialis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gbr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4312336..4313187)
Genome map
AA seq 283 aa AA seqDB search
MGVINVTADSFSDGGRYLDTAAAVEHGLALRAEGADLIDVGGESTRPGAIRVDPDLEAAR
VTPVISALSGHGARISVDTMRASVAAAAIDAGATVVNDVSGGRADADMAKVVADAGLPWI
LMHWRPAGDSTDRHFTHRIGDVGGYRDVVAEVSGELLAQVDAAVSAGVDPDHIILDPGLG
FAKTAEHNWALLHALPTLVGLGFPVLVGASRKRFLGTLLAGDDGTVRPPQERDVATASIS
ALAAMNGAWGVRVHDVAASRDAVAVAAAWRAGGSRSTPDGAHG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatcaacgtgaccgccgactcattctccgacggtggtcgctacctggacacc
gcggccgcggtcgagcacgggctcgccctgcgcgccgagggagccgatctgatcgacgtc
ggcggcgagtcgacccggcccggcgccatccgcgtcgaccccgatctcgaggcggcccgg
gtgacaccggtgatctccgcactttccgggcacggcgcgcgcatctcggtggacaccatg
cgcgcctccgtcgcggccgctgccatcgacgcgggagccacggtcgtgaacgacgtctcg
ggcggccgggcggatgcggacatggccaaggtcgtcgccgacgccggcctgccctggatt
ctcatgcattggcggcccgccggtgacagcaccgaccgtcacttcacccaccgcatcggt
gacgttggcggctaccgcgacgtggtcgcggaggtcagcggcgagttgctcgcgcaggtg
gacgccgcggtctcggccggggtcgaccccgaccacatcatcctcgacccgggactcggg
ttcgccaagacagccgaacacaattgggccctgctccacgcgctgccgaccctcgtcgga
ctcggtttcccggtgctcgtcggggcgtcgcgcaaacgcttcctcggtacgctgctcgcc
ggcgacgacggcaccgtccgcccgccgcaggagcgggacgtggccaccgcgtcgatctcc
gcgctggccgcgatgaacggcgcgtggggcgtgcgcgtgcacgatgtcgcggccagtcgc
gacgcggtcgcggtggcggcggcctggcgcgccggtgggtcgcgctccactccggacggc
gctcatggctga

DBGET integrated database retrieval system