KEGG   Gordonia bronchialis: Gbro_4338Help
Entry
Gbro_4338         CDS       T01102                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00220  Arginine biosynthesis
gbr00250  Alanine, aspartate and glutamate metabolism
gbr00290  Valine, leucine and isoleucine biosynthesis
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01130  Biosynthesis of antibiotics
gbr01210  2-Oxocarboxylic acid metabolism
gbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_4338
   00290 Valine, leucine and isoleucine biosynthesis
    Gbro_4338
   00220 Arginine biosynthesis
    Gbro_4338
Enzymes [BR:gbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Gbro_4338
    2.6.1.66  valine---pyruvate transaminase
     Gbro_4338
Amino acid related enzymes [BR:gbr01007]
 Aminotransferase (transaminase)
  Class I
   Gbro_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Death_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACY23480
UniProt: D0L5Z4
Position
4644695..4646017
Genome map
AA seq 440 aa AA seqDB search
MTAEDDRCVCRENPFAPGCDNVPVSRPHVSHLNQNLKPLEQSLKLQNVCYEIRGPVHAHA
ARLEAEGHRIMKLNIGNPALFGFEAPDVIMRDMIHALPYSQGYSESAGVLSARRAVVTRY
ELIPDFPYFDVDDVILGNGVSELITMTMQALLNDGDEVLIPAPDYPLWTAMTTLSGGRPV
YYRCDEDNGWNPDIDDIASKITERTKAIVIINPNNPTGAVYSREVLEQLVDLAREHSLLI
LADEIYDKILYDDAVHTNVASLAPDLLCLTFNGLSKAYRVCGYRAGWVVITGPKDHATGF
IEGLGILASTRLCSNVPGQHAIQVALGGYQSIDALVEPGGRLYEQRNVTWEKLNEIPGVS
CVKPMGALYAFPRLDPEVHEIHDDELFVQDLLLQEKILVVQGTGFNLEDHNHFRIVTLPW
ARDLNDAIERIGNFLSSYRQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctgaggacgaccgttgcgtatgcagagaaaacccgtttgcgcccggctgcgac
aatgtaccggtgagtaggccacatgtatcccacctgaatcagaacctgaagccgctggag
cagtccctgaagctgcagaacgtgtgctacgagatcaggggacccgtgcacgcgcacgcg
gcgcggctggaggccgagggccaccggatcatgaagctgaacatcggcaacccggccctg
ttcggcttcgaggcccccgacgtcatcatgcgcgacatgatccacgccctcccctactcg
cagggctactcggagtcggccggtgtgctctcggcacggcgtgcggtggtgacccgctac
gagctcatccccgacttcccctacttcgacgtcgacgacgtcatcctcggcaacggtgtc
tccgagctcatcacgatgacgatgcaggcgttgctcaacgacggcgacgaggtgctcatc
ccggcgcccgactacccgctgtggaccgccatgaccacgctgtccggcggacgtccggtc
tactaccgctgcgacgaggacaacggctggaaccccgacatcgacgacatcgcgtcgaag
atcaccgaacgcaccaaggcgatcgtcatcatcaaccccaacaaccccacgggtgccgtg
tactcccgtgaggtgctggagcagctggtggatctggcccgtgagcattcgttgctgatc
ctggccgacgagatctacgacaagatcctctacgacgacgccgtgcataccaatgtcgcc
tcactggccccggacctgctctgcctcaccttcaacggcctgtccaaggcctaccgggtg
tgcggttatcgtgcgggctgggtggtcatcaccggccccaaagatcacgccaccggtttc
atcgagggcctgggcatcctcgcgtcgacgcgcctgtgttccaacgtgcccggtcagcac
gccatccaggtggcgctgggcggctatcagtccatcgatgccctggtggaaccgggcggc
cgcctctacgagcagcgcaatgtgacctgggagaagctcaacgagatccccggcgtcagc
tgtgtgaaaccgatgggcgcgctctacgccttcccccgactcgaccccgaggtccacgag
atccacgacgacgagttgttcgtgcaggacctgctgctgcaggagaagatcctcgtcgtg
cagggcacgggcttcaacctcgaggaccacaaccacttccgcatcgtcacactgccctgg
gcgcgggatctgaacgacgccatcgagcggatcgggaacttcctgtcgtcgtatcggcag
tag

DBGET integrated database retrieval system