KEGG   Gordonia bronchialis: Gbro_4338Help
Entry
Gbro_4338         CDS       T01102                                 

Definition
class I/II aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gbr  Gordonia bronchialis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Gbro_4338
   01230 Biosynthesis of amino acids
    Gbro_4338
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Gbro_4338
   00290 Valine, leucine and isoleucine biosynthesis
    Gbro_4338
Enzymes [BR:gbr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Gbro_4338
    2.6.1.66  valine---pyruvate transaminase
     Gbro_4338
Amino acid related enzymes [BR:gbr01007]
 Aminotransferase (transaminase)
  Class I
   Gbro_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4644695..4646017
Genome map
AA seq 440 aa AA seqDB search
MTAEDDRCVCRENPFAPGCDNVPVSRPHVSHLNQNLKPLEQSLKLQNVCYEIRGPVHAHA
ARLEAEGHRIMKLNIGNPALFGFEAPDVIMRDMIHALPYSQGYSESAGVLSARRAVVTRY
ELIPDFPYFDVDDVILGNGVSELITMTMQALLNDGDEVLIPAPDYPLWTAMTTLSGGRPV
YYRCDEDNGWNPDIDDIASKITERTKAIVIINPNNPTGAVYSREVLEQLVDLAREHSLLI
LADEIYDKILYDDAVHTNVASLAPDLLCLTFNGLSKAYRVCGYRAGWVVITGPKDHATGF
IEGLGILASTRLCSNVPGQHAIQVALGGYQSIDALVEPGGRLYEQRNVTWEKLNEIPGVS
CVKPMGALYAFPRLDPEVHEIHDDELFVQDLLLQEKILVVQGTGFNLEDHNHFRIVTLPW
ARDLNDAIERIGNFLSSYRQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctgaggacgaccgttgcgtatgcagagaaaacccgtttgcgcccggctgcgac
aatgtaccggtgagtaggccacatgtatcccacctgaatcagaacctgaagccgctggag
cagtccctgaagctgcagaacgtgtgctacgagatcaggggacccgtgcacgcgcacgcg
gcgcggctggaggccgagggccaccggatcatgaagctgaacatcggcaacccggccctg
ttcggcttcgaggcccccgacgtcatcatgcgcgacatgatccacgccctcccctactcg
cagggctactcggagtcggccggtgtgctctcggcacggcgtgcggtggtgacccgctac
gagctcatccccgacttcccctacttcgacgtcgacgacgtcatcctcggcaacggtgtc
tccgagctcatcacgatgacgatgcaggcgttgctcaacgacggcgacgaggtgctcatc
ccggcgcccgactacccgctgtggaccgccatgaccacgctgtccggcggacgtccggtc
tactaccgctgcgacgaggacaacggctggaaccccgacatcgacgacatcgcgtcgaag
atcaccgaacgcaccaaggcgatcgtcatcatcaaccccaacaaccccacgggtgccgtg
tactcccgtgaggtgctggagcagctggtggatctggcccgtgagcattcgttgctgatc
ctggccgacgagatctacgacaagatcctctacgacgacgccgtgcataccaatgtcgcc
tcactggccccggacctgctctgcctcaccttcaacggcctgtccaaggcctaccgggtg
tgcggttatcgtgcgggctgggtggtcatcaccggccccaaagatcacgccaccggtttc
atcgagggcctgggcatcctcgcgtcgacgcgcctgtgttccaacgtgcccggtcagcac
gccatccaggtggcgctgggcggctatcagtccatcgatgccctggtggaaccgggcggc
cgcctctacgagcagcgcaatgtgacctgggagaagctcaacgagatccccggcgtcagc
tgtgtgaaaccgatgggcgcgctctacgccttcccccgactcgaccccgaggtccacgag
atccacgacgacgagttgttcgtgcaggacctgctgctgcaggagaagatcctcgtcgtg
cagggcacgggcttcaacctcgaggaccacaaccacttccgcatcgtcacactgccctgg
gcgcgggatctgaacgacgccatcgagcggatcgggaacttcctgtcgtcgtatcggcag
tag

DBGET integrated database retrieval system