KEGG   Gordonia bronchialis: Gbro_4503Help
Entry
Gbro_4503         CDS       T01102                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gbr  Gordonia bronchialis
Pathway
gbr00071  Fatty acid degradation
gbr00280  Valine, leucine and isoleucine degradation
gbr00281  Geraniol degradation
gbr00310  Lysine degradation
gbr00362  Benzoate degradation
gbr00380  Tryptophan metabolism
gbr00410  beta-Alanine metabolism
gbr00640  Propanoate metabolism
gbr00650  Butanoate metabolism
gbr00903  Limonene and pinene degradation
gbr00930  Caprolactam degradation
gbr01040  Biosynthesis of unsaturated fatty acids
gbr01100  Metabolic pathways
gbr01110  Biosynthesis of secondary metabolites
gbr01120  Microbial metabolism in diverse environments
gbr01130  Biosynthesis of antibiotics
gbr01200  Carbon metabolism
gbr01212  Fatty acid metabolism
Module
gbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Gbro_4503
   00650 Butanoate metabolism
    Gbro_4503
  Lipid metabolism
   00071 Fatty acid degradation
    Gbro_4503
   01040 Biosynthesis of unsaturated fatty acids
    Gbro_4503
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Gbro_4503
   00310 Lysine degradation
    Gbro_4503
   00380 Tryptophan metabolism
    Gbro_4503
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gbro_4503
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Gbro_4503
   00281 Geraniol degradation
    Gbro_4503
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Gbro_4503
   00930 Caprolactam degradation
    Gbro_4503
Enzymes [BR:gbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Gbro_4503
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Gbro_4503
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Gbro_4503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N F420_oxidored NAD_binding_2 NAD_binding_8 2-Hacid_dh_C AlaDh_PNT_C NAD_Gly3P_dh_N DAO Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACY23636
UniProt: D0L6S6
Position
complement(4827217..4829379)
Genome map
AA seq 720 aa AA seqDB search
MFVWDKDADGIVVLTMDDPNQGANTMNELFMESVATTVDRLEAEKDDIAGVVITSAKKTF
FAGGDLKDMTSGRGDATKEEIATAITERTNGMKKVLRRLETLGKPVVAAINGAALGGGLE
IALHTHHRIAADVKGNQIGLPEVTLGLLPGGGGVVRTVRLLGIQNALMNVLLQGQRMNPT
KAKEVGVIDEVVGSIEELVPAAKEWIKANPEAAQPWDVKGYKMPGGSVTNPSFAQTLPAL
PSLLRKQIKGANMPAPRNILAAAVEGAYVDVDTADIIETRYFVNLVTGQVAQNMIKAFFF
DLQHINNGGSRPEGIEKYTAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDIEAAKRGK
GYSEKLEEKALSRGKTTQEKSDALLARITPTVDPEDFKGVDLVIEAAFESVEVKHKVFQE
IEDIVEPNAILGSNTSTLPITILAQGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDEV
LAKVIDYTLQIRKTPIVVNDSRGFFTSRVIGTFVNEAIAAVGEGVEPAFIEHAGTQAGYP
AAPLQLMDELTLTLPQKIRKETEAALKAEGKSIPEHGSNAVVDWMVENGRTAKKDGKGFY
DYDENGKRTGLWPGLREQFNSGSTKIPLEDMKERMLFAEALETVKCFDEGVLTSVPDANI
GSIFGIGFPAWTGGVIQYINQYEGGLQGFVDRANDLASKYGKHFEPPQSLVDKAAKGEKF
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgtgggataaggatgccgacggcatcgtcgttctcacgatggacgatccgaat
cagggcgccaacaccatgaacgagctgttcatggaatcggttgcgaccaccgtcgatcgc
ctggaggccgagaaggacgacatcgccggtgtggtgatcacctcggccaagaagaccttc
ttcgccggtggtgacctgaaggacatgaccagcggtcgcggcgacgccaccaaggaggag
atcgccaccgcgatcaccgagcgcaccaacggcatgaagaaggtgctgcgccggctcgag
accctcggcaagccggtcgtcgccgccatcaacggcgccgccctcggtggtggcctcgag
atcgcgctgcacacccatcaccgcatcgcggcggacgtgaagggcaaccagatcggcctg
cccgaggtgaccctgggcctgctgcccggtggcggcggcgtggtgcgtaccgtgcgtctg
ctcggtatccagaacgcgctgatgaacgtgctcctgcagggccagcggatgaacccgacc
aaggccaaggaagtcggtgtcatcgacgaggtcgtcggctcgatcgaggagctggtcccg
gccgccaaggaatggatcaaggccaacccggaagctgctcagccgtgggatgtcaagggc
tacaagatgcccggcggttcggtgaccaacccgtcgttcgcgcagaccctgccggcgctg
ccgtcgttgctgcgcaagcagatcaagggcgccaacatgccggccccgcgcaacatcctg
gccgccgcggtcgagggtgcctacgttgacgtcgacaccgccgacatcatcgagacccgc
tacttcgtgaatctggtgaccggtcaggtcgcgcagaacatgatcaaggcgttcttcttc
gacctgcagcacatcaacaacggtggctcgcggcccgagggcatcgagaagtacaccgcc
aagaaggtcggcgtcatcggcgccggcatgatgggtgcggccatcgcctacgtgtcggcc
aaggccggtatcgaggtggtgctcaaggacatcgacatcgaggccgccaagcgtggcaag
ggctactcggagaagctcgaggagaaggcgctctcgcggggcaagaccacgcaggaaaag
tccgacgcgctgctggcccggatcaccccgaccgtcgatcccgaggacttcaagggcgtc
gacctcgtcatcgaggcggccttcgagtcggttgaggtgaagcacaaggtcttccaggag
atcgaggacatcgtcgagccgaacgccatcctgggttcgaacacctccacgctgccgatc
acgatcctcgcccagggcgtcaagcgccaggaggacttcatcggcatccacttcttctcg
ccggtcgacaagatgccgctggtggagatcatccgcggtgagaagacctcggatgaggtg
ctggccaaggtgatcgactacacgctgcagatccgcaagacgccgatcgtcgtcaacgac
agccgtggcttcttcaccagccgcgtcatcggcacctttgtcaacgaggccatcgcggct
gtcggcgaaggtgtggagccggcgttcatcgagcatgcgggcacccaggccggttacccg
gccgcaccgctgcagctgatggacgagctgaccctgacgctgccgcagaagatccgcaag
gagaccgaggccgcgctgaaggcggagggcaagtcgatccccgaacacggttccaacgcc
gtcgtcgactggatggtcgagaacggtcgcaccgccaagaaggacggcaagggcttctac
gattacgacgagaacggcaagcgcaccgggctgtggccgggcctgcgcgagcagttcaac
tcgggcagcaccaagatcccgctggaggacatgaaggagcgcatgctcttcgccgaggcg
ctcgagaccgtgaagtgcttcgacgagggtgtgctcacctccgtccccgacgccaacatc
ggctcgatcttcggcatcggattcccggcctggaccggtggtgtcatccagtacatcaac
cagtacgagggtggcttgcagggcttcgtcgaccgcgccaacgacctggcgtcgaagtac
ggcaagcacttcgagcccccgcagtcgctggtcgacaaggctgccaagggtgagaagttc
tga

DBGET integrated database retrieval system